Advanced search



 
 79.5% of the records
 
 20.5 % of the records
 
 57.5 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademicacademic backgroundacademic barrieracademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumablack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1C3cability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCameroonCanadaCanadiancanal syndromecancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1cold applicationcold temperaturecoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxishair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand painhand strengthhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien TettambelmembershipmembranesmemorymemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial disparityracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

6465 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02
2

Syndrome des releveurs de l’anus, troubles fonctionnels intestinaux et anomalies articulaires du petit bassin, place du traitement ostéopathiqueLevator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment
(Levator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment)
Riot, F. M., Goudet, P., Mouraux, J. P., Cougard, P.
La Presse Medicale, Jul 31
3

Interexaminer reliability studies: spanning a gap in medical research--Louisa Burns Memorial Lecture
Johnston, W. L.
J Am Osteopath Assoc, Aug
4

Proposal for Manual Osteopathic Treatment of the Phrenic Nerve
Bordoni, B., Escher, A. R., Duczyński, M.
Cureus, Apr
5

ОСТЕОПАТИЯ КАК ИННОВАЦИОННЫЙ ВЕКТОР В ВОССТАНОВИТЕЛЬНОЙ И СПОРТИВНОЙ МЕДИЦИНЕ
Osteopathy as an innovative Approach to Rehabilitation and Sports Medicine
Vovkogon, A., Sankova, M., Nikolenko, V., Oganesyan, M., Gridin, L.
Human Sport Medicine, 23/08
Free full text
6

Touch-based treatments and infantile colic - Parental perceptions of treatment outcomes related to infants' crying and sleeping
Hannula, L., Rinne, S., Väänänen, T., Aarva, P., Suvilehto, J., Kemppainen, T.
Journal of Pediatric Nursing, 2026/01
Free full text
7

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12
8

Trends in retention and attrition among osteopaths in Australia: Insights from the workforce retention and Attrition Project
Lathlean, T., Orrock, P., Malon, R., McNamara, T., Tan, J., Divakar, R., Barclay, L., Woodward, C., Saar, E.
International Journal of Osteopathic Medicine, 2025/12
Free full text
9

General Osteopathic Treatment: Status quo – Teil 2
(General Osteopathic Treatment: Status Quo – Part 2)
Engel, M.
Osteopathische Medizin, 2025/12
10

Geschichte des osteopathischen Ansatzes für den ganzen Körper
(History of the osteopathic approach to the whole body)
Jarvis, L.
Osteopathische Medizin, 2025/12
11

Prämenstruelle Beschwerden: Mögliche Auswirkungen auf das PMS durch eine lymphspezifische osteopathische Techniksequenz – eine randomisiert-kontrollierte Pilotstudie
(Premenstrual symptoms: Potential effects on PMS of a lymph-specific osteopathic technique sequence – a randomized controlled pilot study)
König, A.
Osteopathische Medizin, 2025/12
12

Wie geht Beruf? – Teil 1: Gesetzgebungsverfahren, Heilberufe und Status quo der Osteopathie in Deutschland
(How does the profession work? – Part 1: Legislative process, healthcare professions, and the status quo of osteopathy in Germany)
Newiger, C.
Osteopathische Medizin, 2025/12
13

Breathing retraining and manual therapy for long COVID – A literature review
Courtney, R., Steele, Z., Collyer, I.
International Journal of Osteopathic Medicine, 2025/12
Free full text
14

The outcome of a short course of osteopathy for older adults with chronic musculoskeletal (MSK) pain. A single-arm, prospective feasibility study
Orchard, D., Bolt, D., Pinna, T., Antoni-Pineda, G.
International Journal of Osteopathic Medicine, 2025/12
15

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12
16

Osteopathic Acceptance in General Surgery Residency: A Five-Year Review of Resident Outcomes
Baule, S. M., Nguyen, J., Mehdiyar, D., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J., Johnson, R., Sees, J. P.
Cureus, 2025/12
Free full text
17

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text
18

Osteopathic Manipulative Treatment Protocol for Postoperative Care Following Abdominal Surgery: A Quality Improvement Project
Genewick, J., Amendolara, A., Robinson, S., McDonough, M., Loera, M., Stacey, S. K.
Cureus, 2025/12
Free full text
19

Integrating Cranio-Cervical Neuromyofascial Continuity With Body-Wide Function in Kimmerle Anomaly: An Osteopathic Case Report
Pizzolorusso, G., Borraccia, V., Quaranta, C., D'Alessandro, G., Lunghi, C.
Cureus, 2025/12
Free full text
20

Osteopathic Manipulative Treatment Plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Rajala, J. W., Miller, D. J.
AAO Journal, 2025/12
Free full text
21

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
AAO Journal, 2025/12
22

Treatment of Temporomandibular Joint Pain and Dysfunction After a Motor Vehicle Accident Using an Osteopathic Approach: A Case Study
Schneider, N., Schneider, D., Sinnott, M., Kurian, A., Widboom, N., Qureshi, Y.
AAO Journal, 2025/12
23

Cancer Prevention and Therapy With Nutritional Science: Addressing the Gap in Medical Education and Practice
Collignon, T. E., Bishayee, A.
MedComm, 2025/11
Free full text
24

DO and MD Enrollment in U.S. Dermatology Residencies Following the Graduate Medical Education Merger: Implications for Access
Park, L., Beach, S., Glick, B. P., Benedetto, A. V.
Clinical Dermatology, 2025/11
25

Osteopathic manipulative treatment improves mobility restrictions and statics in a patient with a pectus excavatum after a sternochondroplasty. A case report
Jeandey, K., Le Nohaïc, A., Solovei, L., Gourjon, G.
Explore, 2025/11
26

Cross-sectional Survey of the Evidence Implementation Environment of the Australian Chiropractic and Osteopathic Professions
Leach, M. J.
Journal of Manipulative and Physiological Therapeutics, 2025/11
27

Predictability of cranial base strains as related to birth presentation: a review of literature
McElwain, S. K., Schmidt, D.
Journal of Osteopathic Medicine, 2025/11
Free full text
28

The role of osteopathic manipulative medicine in cerebral palsy: bridging treatment gaps and enhancing care
Ngo, A. L., Gharavi Alkhansari, N., Tadakamalla, R., Hess, M., Nguyen, U. T., Yazji, J., Rogers, R. S.
Journal of Osteopathic Medicine, 2025/11
Free full text
29

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2025/11
Free full text
30

Osteopathic manipulative treatment in the management of headaches associated with musculoskeletal dysfunction: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Ying-Fang Wang, M., Johnston, R., Will, M., Gibson, E., Spencer, D., Garcia, C., Snider, K. T.
Journal of Osteopathic Medicine, 2025/11
Free full text
31

Osteopathie bei Transidentität - Eine Einzelfallstudie zum Einfluss auf Lebensqualität, Cortisolwerte und Wohlbefinden bei einem transgender Jugendlichen unter Hormontherapie
(Osteopathy in Transgender Identity - A Single-Case Study on the Impact on Quality of Life, Cortisol Levels, and Well-being in a Transgender Adolescent Undergoing Hormone Therapy)
Gugatschka, N.
Unpublished MSc thesis, 2025/11
32

Osteopathische Behandlungsansätze bei gastrointestinalen Beschwerden
(Osteopathic treatment approaches for gastrointestinal complaints)
Leitner, S.
Unpublished MSc thesis, 2025/11
33

Einfluss einer Behandlung der reziproken Spannungsmembran, insbesondere des Tentorium cerebelli, auf das vegetative Nervensystem
(Influence of treatment of the reciprocal tension membrane, in particular the tentorium cerebelli, on the autonomic nervous system)
Schweiß, E.
Unpublished MSc thesis, 2025/11
34

A preliminary study on the effect of quantified cranial osteopathic manipulation on wild-type and transgenic rat models of Alzheimer's disease
Hines, D., Tobey, H., Dugan, P., Boehringer, S., Helm, R., Anandakrishnan, R., Werre, S., VandeVord, P., Costa, B. M.
Journal of Alzheimer's Disease Reports, 2025/11
Free full text
35

Efficacy of Musculoskeletal Manipulation for Endoscopic Discomfort in Patients Undergoing Upper Gastrointestinal Endoscopy and Colonoscopy: A Systematic Review and Meta-Analysis
Kitamura, S., Komiya, S., Kaneko, T., Tsuge, T., Watanabe, J.
Cureus, 2025/11
Free full text
36

Evaluating Community Awareness of Osteopathic Manipulative Medicine and New Educational Programs in Fresno County, United States: A Cross-Sectional Survey
Mazdeyasnan, L., Shabbir, Z., Ham-Ying, J.
Cureus, 2025/11
Free full text
37

New Zealand osteopaths and the management of sport-related injury: outcomes from a practice-based research network
Tripodi, N., Fleischmann, M., Muddle, L., McLeod, G., Treffel, L., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2025/10
Free full text
38

Evaluation of Craniosacral Therapy Effects on Brain Wave Patterns in Children with Mild Autism Spectrum Disorder Using the QEEG Method
Kopańska, M., Szczygielski, J., Batrman, P., Banaś-Ząbczyk, A.
Acta Neuropsychologica, 2025/10
Free full text
39

Evaluating the acute effect of osteopathic manipulative treatment on sprint performance in young adults
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., McKinlay, K. J., Roush, A. J., Cosgrave, C.
Journal of Osteopathic Medicine, 2025/10
Free full text
40

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text
41

Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Bethea, J., Sharma, H., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
Cureus, 2025/10
Free full text
42

Exploring the use of manual therapy in the management of traumatic brain injury: a scoping review
Delion, T., Noyer, A., Gonzalès-Bandrès, M., Treffel, L., Farrell, G., Cassoudesalle, H., Ménard, M.
Chiropractic and Manual Therapies, 2025/10
Free full text
43

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text
44

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text
45

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10
46

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text
47

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10
48

Osteopathic manipulative treatment for refractory chronic traumatic pain and mobility restrictions at a level 1 trauma center
Baltazar, G. A., Cao, M., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Petrone, P., Islam, S., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/10
Free full text
49

Visceral Osteopathy in Treating Refractory Irritable Bowel Syndrome: Results of a French National Multicentre Randomised Controlled Trial
Wuestenberghs, F., Sabate, J. M., Jouet, P., Mion, F., Vidon, M., Piche, T., Napoléon, M., Roman, S., Soliman, H., Benallaoua, M., Bouchoucha, M., Benamouzig, R.
United European Gastroenterology Journal, 2025/10
50

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10
51

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10
52

Assessing Osteopathic Medical Student Knowledge of Common Vitamin and Mineral Deficiencies
Stevens, A. A., Weir, S. B.
Cureus, 2025/10
Free full text
53

Dr. William Garner Sutherland (1873-1954): A Pioneer in Cranial Osteopathy
Griswold, S. R., Brask, A. S., Bhakta, K. D., Campbell, A. M., Smith-Gonzalez, A. R.
Cureus, 2025/10
Free full text
54

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text
55

The Predictors of COMLEX-USA (Comprehensive Osteopathic Medical Licensing Examination of the United States) Level 1 Success Among Osteopathic Medical Students: The Role of Study Habits and Post-baccalaureate Background
Shults, R., Belizaire, S., Kennedy, C., Chosie, K.
Cureus, 2025/10
Free full text
56

Jaw Functional Orthopedics and Osteopathic Approaches As Adjunctive Treatment for Idiopathic Scoliosis: A Case Report
Valério, P., Vasilyeva, M.
Cureus, 2025/10
57

Osteopathische Behandlung bei akuter Tendovaginitis de Quervain
(Osteopathic treatment for acute De Quervain's tendovaginitis)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
58

Interrater Reliability of a Manual Diagnostic Protocol for Pancreatic Functional Visceral Dysfunction
Faria, M., Machado, N., de Sousa, M. C., Pires, P. M., Pires, T.
Journal of Integrative and Complementary Medicine, 2025/09
59

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
60

Technology use and satisfaction among colleges/schools of osteopathic medical education
Linsenmeyer, M., Ridpath, L.
Journal of Osteopathic Medicine, 2025/09
Free full text
61

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2025/09
Free full text
62

Osteopathic manipulative treatment in a patient with idiopathic scoliosis assessed by breathing pattern characterization using optoelectronic plethysmography and quality of life — a case report
Gaillard, L., Stubbe, L., Riquet, D., Houel, N.
Journal of Bodywork and Movement Therapies, 2025/09
Free full text
63

Differences in practice among osteopaths in the UK with more than or less than 10 years of experience: a cross-sectional study
Bailey, D., Fawkes, C., Draper-Rodi, J.
BMJ Open, 2025/09
Free full text
64

Exploring Manual Interventions for Infantile Colic: A Scoping Review of the Evidence
Tedeschi, R., Giorgi, F.
Children, 2025/09
Free full text
65

Effect of the Spencer Technique on Glenohumeral Joint Range of Motion: A Comparative Analysis of Athletes Versus Non-athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Cureus, 2025/09
Free full text
66

Manual Therapy in Post-operative Knee Management: A Systematic Review of Effects on Pain in Total Knee Replacement (TKR) Patients
Sahni, S., Fares, J. E., Jordan, H.
Cureus, 2025/09
Free full text
67

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Kovanur Sampath, K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/09
68

Effects of the COVID-19 Pandemic on the Practice of Osteopathic Manipulative Medicine: A Survey Study
Luebbering, C. J., Johnson, J. C., AminiRad-Hall, S., Kelley-Franklin, G., Degenhardt, B. F.
International Journal of Osteopathic Medicine, 2025/09
69

Effect of osteopathic manipulative treatment on primary pelvic pain - A systematic review with meta-analysis
Parada, J. G., da Silva, E. B., Fernandes, A. P., Portugal, G. B.
International Journal of Osteopathic Medicine, 2025/09
70

Attitudes, Beliefs, and Values of Italian Osteopaths Toward the Management of Patients With Tension-Type Headache: A Categorical Content Analysis
Iacopini, A., Esteves, J. E., Consorti, G., Lunghi, C., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2025/09
71

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2025/09
Free full text
72

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09
73

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text
74

Academic Background Affects Students’ Confidence and Anxiety Levels about Undergraduate Osteopathic Medical Education
Jambunathan, V.
Spartan Medical Research Journal, 2025/09
75

The Rule of the Artery: Management of Peripheral Vascular Disease with Osteopathic Manipulative Treatment in a Low Resource Setting in Iquitos, Peru
Kamm, M.
Spartan Medical Research Journal, 2025/09
76

A Pediatrician’s Newest Tool: Osteopathic Manipulative Treatment in the Inpatient Setting
Khanafer, R., Holub-Ward, R., Wong, M., Hart, C., Pitman-Hunt, C.
Spartan Medical Research Journal, 2025/09
77

Assessing Osteopathic Medical Students’ Perceptions on Training to Identify Social Determinants of Health: A Pilot Study in a Detroit Street Medicine Program
Nallabelli, N.
Spartan Medical Research Journal, 2025/09
78

The Use of OMT in the Emergency Department: A Scoping Review
Nemes, P.
Spartan Medical Research Journal, 2025/09
79

Quand l’ostéopathe attire plus que l’hôpital : réflexions sur la centralisation informelle des soins musculosquelettiques autour d’un praticien rare au Cameroun
(When the osteopath attracts more than the hospital: Reflections on the informal centralization of musculoskeletal care around a rare practitioner in Cameroon)
Npochinto Moumeni, I.
Kinesitherapie, 2025/09
80

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2025/09
81

The Emerging Role of Osteopathic Manipulative Medicine in Enhancing Quality of Life for Palliative and End-of-Life Patients: A Narrative Review
Ngo, A. L., Nguyen, L., Shahbandeh, C., Nichols, J.
Cureus, 2025/09
Free full text
82

Osteopathy Educators’ and Researchers’ Perspectives on Artificial Intelligence in Academia: A Cross-Sectional Study
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2025/09
83

COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial
Martinez, E. S., Fuchs, S., Szurmant, H., Chen, X., Comer, A., Lee, E., Hruby, R., Giusti, R., Loveless, B., Sees, J. P., Crone, P., Peek, L. J., Pestano, G., Xie, B., Zammuto, J., Hostoffer Jr., R., Sanchez Jr., J.
Virus Research, 2025/09
Free full text
84

Étude de faisabilité LEUCOSTEO : intervention par ostéopathie dans l’accompagnement d’enfants ayant une leucémie aiguë lymphoblastique
(LEUCOSTEO interventional pre-study: Evaluation of osteopathic support needs in the context of acute lymphoblastic leukemia)
De Mauljean, M., Chaillou, D., Mattatia, J., Baldo, C., Gouaux, L., Dalle, J.H., Stubbe, L., Brethon, B.
Douleurs, 2025/09
85

General Osteopathic Treatment: Status quo – Teil 1
(General Osteopathic Treatment: Status Quo – Part 1)
Engel, M.
Osteopathische Medizin, 2025/09
86

Post-/Long-COVID-Syndrom und Post-Vac-Syndrom: Können uns in der Therapie alte Überlegungen helfen?
(Post-/Long-COVID syndrome and post-vaccination syndrome: Can old ideas help us in treatment?)
Heinz, J.
Osteopathische Medizin, 2025/09
87

Interdisziplinäre Perspektiven auf die Ankyloglossie: Diagnostik, Therapie und Evidenz
(Interdisciplinary perspectives on ankyloglossia: diagnosis, treatment, and evidence)
Moghtader, D., Vogt, R.
Osteopathische Medizin, 2025/09
88

Praktische Umsetzung der Studienergebnisse zur Osteopathie bei Dysmenorrhö
(Practical implementation of study results on osteopathy for dysmenorrhea)
Plathner, M.
Osteopathische Medizin, 2025/09
89

Post-COVID-19 Respiratory Dysfunction and Musculoskeletal Pain: Improvement with Osteopathic Manipulative Treatment (OMT)
Dehghani Ashkezari, A., Graber, Z., Yao, S. C.
The AAO Journal, 2025/09
90

The Use of Osteopathic Manipulative Treatment for a Case of Constipation in Childhood
Heineman, K.
The AAO Journal, 2025/09
91

Tipping the scale: Enhancing Neurological Recovery in TBI through Osteopathic Principles
Khanna, N., Ettlinger, H., Shugar, J. D.
The AAO Journal, 2025/09
92

Impact of Osteopathic Manipulative Treatment on Improving Function and Restoring Quality of Life After Sternoclavicular Joint Resection
Krueger, A., Schaefer, M.
The AAO Journal, 2025/09
93

Osteopathic Manipulative Treatment (OMT) as an Adjunctive Treatment in Major Depressive Disorder (MDD)
Moreno, P., Mather, M., Kinney, L., Pichot, R., Torres, R.
The AAO Journal, 2025/09
94

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09
95

Emotional Release of a Male with Somatic Symptom Disorder (SSD) via Osteopathic Manipulative Treatment (OMT)
Tedjo, W., Shugar, J. D.
The AAO Journal, 2025/09
96

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09
97

Osteopathic correction as part of complex treatment of delayed speech and mental development in preschool children
(Остеопатическая коррекция в составе комплексного лечения задержки речевого и психического развития у детей дошкольного возраста)
Abubakarova, E. N., Stenkova, O. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
98

Comparison of clinical effectiveness of osteopathic correction and massage in the treatment of cervicalgia in surgical specialists experiencing prolonged professional overloads
(Сравнение клинической эффективности остеопатической коррекции и массажа в терапии цервикалгии у специалистов хирургического профиля, испытывающих продолжительные профессиональные перегрузки)
Belash, V. O., Plotnikova, E. N.
Russian Osteopathic Journal, 2025/09
99

Physiological substantiation of the effect of mechanical impact on internal organs (literature review
(Физиологическое обоснование влияния механических воздействий на внутренние органы (обзор литературы)
Ikhlef, A., Potekhina, Y. P., Simenko, E. V.
Russian Osteopathic Journal, 2025/09
100

Combined rehabilitation of patients after acute cerebrovascular accident in the early recovery period: the role of osteopathic correction
(Комбинированная реабилитация пациентов после острого нарушения мозгового кровообращения в раннем восстановительном периоде: роль остеопатической коррекции)
Makichyan, T. G., Rylsky, A. V., Melkosyants, D. I.
Russian Osteopathic Journal, 2025/09
101

Is osteopathic treatment appropriate for a patient with multimorbidity?
(Уместно ли остеопатическое лечение пациенту с мультиморбидностью?)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/09
102

Effect of osteopathic correction on the outcome of pregnancy and childbirth in women with chronic pyelonephritis
(Влияние остеопатической коррекции на исход беременности и родов у женщин с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
103

Gastrointestinal motility disorder in celiac disease: influence of osteopathic correction
(Нарушение моторики органов желудочно-кишечного тракта при целиакии: влияние остеопатической коррекции)
Oreshko, A. Y., Mokhov, D. E., Tregubova, E. S., Oreshko, L. S.
Russian Osteopathic Journal, 2025/09
104

Предпосылки к формированию личного бренда врача-остеопата
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2025/09
105

Centering the Medical Student Perspective in a Mixed-Methods Evaluation of the Holistic Admissions Process at a Mission-Driven Institution
Liszka, B. L.
Unpublished PhD thesis, 2025/08
Free full text
106

Characteristics of Australian and New Zealand osteopaths who treat patients presenting with non-musculoskeletal complaints: outcomes from two practice-based research networks
Vaughan, B., Cerritelli, F., Draper-Rodi, J., Feehan, J., Ferreira, A. P. A., Fleischmann, M., McLeod, G., McIntyre, C., Morin, C., Muddle, L., Thomson, O. P., Treffel, L., Tripodi, N., Sampath, K. K., Sposato, N. S., Steel, A., Adams, J.
Chiropractic & Manual Therapies, 2025/08
Free full text
107

The Need for Telehealth Education in the Medical School Curriculum
Carney, M., Thornton, M. E., Avancha, K., Nolin, J. R., Alexander, J.
Cureus, 2025/08
Free full text
108

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text
109

Clinical Reasoning and Practices in the Osteopathic Management of Visceral Disorders: A Grounded Theory Study in the Italian Context
Camonico, T., Lippi, F., Rizzo, N., Barusso, A., Rossettini, G., Villafañe, J. H., Cerritelli, F., Papa, L., Esteves, J. E.
Healthcare, 2025/08
Free full text
110

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text
111

Feasibility of Osteopathic Manipulative Treatment for Low Back Pain in Rural Chimaltenango, Guatemala: A Pilot Study
Aspra Rubi, M., Ngo, A. L. T., Cooper, G., Nichols, J.
Cureus, 2025/08
Free full text
112

Integrating a Microbiology Laboratory Improves the Attitudes and Performance of First-Year Osteopathic Medical Students
Hrach, V. L.
Cureus, 2025/08
Free full text
113

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08
114

Concussion Best Practice Guidelines for Return to Activity and the Role of Occupational Therapy: Effects of an Education Module for Medical Students
Finn, C.
Brain Injury, 2025/08
115

Rezul'taty primeneniya manual'noi terapii pri degenerativnykh zabolevaniyakh pozvonochnika s radikulopatiei i bez nee (Obzor literatury)
(Results of manual therapy in degenerative spine diseases with and without radiculopathy (Literature review))
Gameeva, E. V., Miryutova, N. F., Badalov, N. G., Novikov, Y. O., Stepanova, A. M., Tonkoshkurova, A. V.
Problems of Balneology, Physiotherapy and Exercise Therapy, 2025/08
116

Die Auswirkungen der osteopathischen Behandlung bei Patientinnen und Patienten mit der gastroösophagealen Refluxkrankheit
(The Impact of Osteopathic Treatment on Patients with Gastroesophageal Reflux Disease)
Hauck, R.
Unpublished MSc thesis, 2025/08
117

Therapeutische Kompetenz, Erfolge und Grenzen osteopathischer Intervention bei Patient:innen mit Demenz
(Therapeutic Competence, Outcomes, and Limitations of Osteopathic Interventions in Patients with Dementia)
Iwobi, A.
Unpublished MSc thesis, 2025/08
118

Association of neurovascular events with cervical manual therapy: A cohort study
Fraser, J. J., Lonnemann, E.
International Journal of Osteopathic Medicine, 2025/08
119

Effect of osteopathic manipulation on neck kinematics using X-Sens motion capture in non-specific neck pain: a protocol for randomised controlled trial
Hullumani, S., Qureshi, I., Raghumahanti, R.
BMJ Open Sport and Exercise Medicine, 2025/08
Free full text
120

Specific osteopathic diagnosis of unilateral knee pain in an elite sprinter: a case report
Mattatia, J., Leplat, A., Saiz, S.
International Journal of Osteopathic Medicine, 2025/08
121

Osteopaths' attitudes, skills and use of evidence-based practice in Portugal
Nunes, A., Santo, J. E., Moita, J.
International Journal of Osteopathic Medicine, 2025/07
122

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text
123

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome in pregnancy from an osteopathic point of view)
Schneider-Milo, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
124

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
125

Find it, find it, find it …
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
126

Ultrasound shear wave elastography to assess neck somatic dysfunction and OMT effects
Gao, J., Lynch, E., Coleman, M., Moore, J., Park, D., Wilde, B.
Journal of Osteopathic Medicine, 2025/07
Free full text
127

A multimodal intervention of manual therapy, exercise, and psychological management for painful diabetic neuropathy: intervention development and feasibility trial protocol
Hohenschurz-Schmidt, D., Smith, S., Schmid, A. B., Bright, P., Draper-Rodi, J., Evans, M. C., Kemp, H., Esteves, N. K., Pigott, E., Scott, W., Vollert, J., Williamson, E., Pogatzki-Zahn, E. M., Vogel, S.
Pain Management, 2025/07
Free full text
128

Geographical distribution and match trends of osteopathic residents in otolaryngology residency programs: a cross-sectional analysis
Reardon, L., Stucki, B., Akella, D., Carr, M. M.
Journal of Osteopathic Medicine, 2025/07
Free full text
129

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2025/07
Free full text
130

Development of a research mentorship program for Australian osteopaths
Eaves, S., Steel, A.
International Journal of Osteopathic Medicine, 2025/07
131

Effect of positional asymmetry palpatory models on improvement and retention of accuracy during pelvic asymmetry assessments
Hajicek, J. M., Huhn, M. B., Thurgood, A., Isemann, E. N., Barnwell, C. B., Starks, Z., Ying-Fang Wang, M., Degenhardt, B. F.
Journal of Osteopathic Medicine, 2025/07
Free full text
132

Effects of a myofascial and lymphatic osteopathic manipulative treatment protocol on mood and body connection: a randomized pilot study
Levy, E. C., Jung, M.K.
Journal of Osteopathic Medicine, 2025/07
Free full text
133

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2025/07
Free full text
134

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text
135

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text
136

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text
137

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text
138

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07
139

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text
140

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text
141

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text
142

Effect of osteopathic manipulative treatment on comorbid depressive symptoms in patients with chronic low back pain: study protocol for a randomised controlled trial
Bohlen, L., Eggart, M., Müller-Oerlinghausen, B., Lorenz, J., Schleip, R., Liem, T., Cerritelli, F., Esteves, J. E., Shedden-Mora, M., Schmidt, T.
BMJ Open, 2025/07
Free full text
143

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07
144

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text
145

Development of a national osteopathic Practice-Based Research Network (PBRN): the NCOR Research Network
Draper-Rodi, J., Fawkes, C., Bailey, D.
Scientific Reports, 2025/07
Free full text
146

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text
147

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/07
148

A Holistic Approach to Treatment of Rosacea During Pregnancy: A Systematic Review
Garelick, E., Hurley, M., Bell, L. N., Cubelli, S.
SKIN: Journal of Cutaneous Medicine, 2025/07
Free full text
149

Pilot study on the influence of osteopathic manual therapy on cortisol and testosterone concentrations in horses
Vokietytė-Vilėniškė, G., Babarskaitė, G., Poškienė, I., Anskienė, L., Žilaitis, V.
Acta Veterinaria Brno, 2025/07
150

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text
151

The combined effect of biofeedback training and osteopathic procedures for the treatment of functional daytime urinary incontinence: A prospective, randomized clinical trial
Elgohary, H. M. I., Elfahl, A. M., Elkholy, M. N.
Journal of Bodywork and Movement Therapies, 2025/06
152

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06
153

Osteopathische Behandlung bei Säuglingskolik/exzessivem Schreien: Eine prospektive, multizentrische, randomisierte, kontrollierte Studie
(Osteopathic treatment for infant colic/excessive crying: A prospective, multicenter, randomized, controlled trial)
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
Osteopathische Medizin, 2025/06
154

Osteopathische Behandlung eines Reizdarmsyndroms
(Osteopathic treatment of irritable bowel syndrome)
Scheuchl, F., Spohr, G.
Osteopathische Medizin, 2025/06
155

Technik zur Behandlung des Sonnengeflechts (Ganglia coeliaca)
(Technique for treating the solar plexus (celiac ganglia))
Liem, T.
Osteopathische Medizin, 2025/06
156

Die doppelte Facette der Identität der Osteopathie
(The dual facet of osteopathy's identity)
L'Hermite, P.L.
Osteopathische Medizin, 2025/06
157

INIOST-Studienreport 2024: Eine bibliometrische Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2024
(INIOST Study Report 2024: A bibliometric overview of osteopathic studies published worldwide in 2024)
Franke, H.
Osteopathische Medizin, 2025/06
158

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06
159

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text
160

Shaft femoral fracture secondary to osteopathic manipulation: case report and medico-legal implication
Prevot, L. B., Bolcato, V., Fozzato, S., Tronconi, L. P., Basile, G.
International Journal of Osteopathic Medicine, 2025/06
161

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text
162

Article Review: Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Daugereaux, S.
The AAO Journal, 2025/06
163

An Osteopathic Strategy for the Recognition and Management of Cervicogenic Vertigo: A Case Study
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2025/06
164

Correlation of Ankyloglossia and Breastfeeding Difficulties in Infants Referred for Osteopathic Manipulation at a Family Medicine Residency Clinic: A Retrospective Chart Review
Bendrick, T., White, M., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
165

Osteopathic Treatment Decreases Pain and Opioid Use in Children with Acute Sickle Cell Disease Pain
Brown, A., Goubeaux, D., Belsky, J.
The AAO Journal, 2025/06
166

Use of Osteopathic Manipulative Medicine in Treatment of Neurologic Sequelae of Sjögren’s Syndrome
Campbell, K., Ettlinger, H. M.
The AAO Journal, 2025/06
167

Functional Improvement without the Surgery Referral, A Case Presentation
Candelori, W. J., Gailius, G. C.
The AAO Journal, 2025/06
168

When the Framework Fails: The Cost of Overlooking the Basics in Chest Pain
Collingsworth, M., Schaefer, M., Emmons, A.
The AAO Journal, 2025/06
169

The Use of Osteopathic Manipulative Medicine During the Inpatient Evaluation for Acute Coronary Syndrome
Coppinger, C., Rit, N., Coppinger, J.
The AAO Journal, 2025/06
170

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06
171

Resolving Deep Gluteal Syndrome with OMT
Dirusso, E., Shugar, J.
The AAO Journal, 2025/06
172

Rhabdo Resuscitation and Recovery Using Osteopathic Manipulative Treatment
Fadenrecht, H., Thorsvik, N.
The AAO Journal, 2025/06
173

Novel COL4A1-related phenotype: generalized hypermobility in a patient with heterozygous missense mutation at NM_001845.6(COL4A1): c.4006G>A (p. Val1336Ile)
Mingo, E. N., Unger, M. J. Jr.
The AAO Journal, 2025/06
174

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma—Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
175

OMT for TBI: A Case Report Showing Improvements in Vision, Mastication, and Post-Traumatic Headaches
Schneider, G., Garrison, S.
The AAO Journal, 2025/06
176

Patterns of OMT Use Across Diverse Practice Settings: Insights from a Multicenter Healthcare System
Toor, J., Stacey, S.
The AAO Journal, 2025/06
177

Osteopathic manipulative treatment and breastfeeding, correlation between age at presentation, mode of delivery, and LATCH scores: a retrospective chart review
White, M., Bendrick, T., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
178

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06
179

Tic Douloureaux: Applied Osteopathy for a Case of Refractory Trigeminal Neuralgia
Wright, J., Thorsvik, N.
The AAO Journal, 2025/06
180

The Impact of Simulated Osteopathic Manipulative Medicine Hospital Rounds on Student Confidence and the Likelihood of OMT Use During Clinical Clerkships
Abdulnour, T., Pryor, J., Chun, L.
The AAO Journal, 2025/06
181

Utilizing Osteopathic Manipulative Medicine to Support Lifestyle Behavior Change: A Case Report
Arnold, C., Bercaw, K., Branda, A.
The AAO Journal, 2025/06
182

Look What The Stork Brought; Osteopathic Manipulative Treatment for Postpartum Foot Drop: A Case Study
Bethea, J., Waters, H.
The AAO Journal, 2025/06
183

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06
184

Visceral Manipulation as a Non-Surgical Approach to Resolving Small Bowel Obstruction: A Case Report of a 77-Year-Old Male
Chung, E. S., Kania, A.
The AAO Journal, 2025/06
185

Hand & Helmet: A Crown-to-Coccyx Approach for Positional Plagiocephaly
Enniss, A., Neuer, K., Whitaker, Z., Ural, E.
The AAO Journal, 2025/06
186

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06
187

Osteopathic Manipulative Treatment (OMT) in the Management of a Young Male with Lewy Body Dementia (LBD): A Case Study
Finkelstein, A., Radigan, R., Yao, S. C.
The AAO Journal, 2025/06
188

Management of Chemotherapy Induced Strains in a Breast Cancer Survivor with OMT
Johnson, R., White, E., Yu, X., Aldridge, A. F., Bardowell, A.
The AAO Journal, 2025/06
189

Turning the Tie: The Impact of OMT on infant torticollis and tongue tie
Lee, D. W., Katyal, J., Faillace, R.
The AAO Journal, 2025/06
190

Osteopathic Manipulative Treatment in a Case of a Runner with Long-COVID and Autonomic Dysregulation
Lupori, E., Bowen, S., Le, B.
The AAO Journal, 2025/06
191

Clavicular Dysfunctions: An Osteopathic Approach to Neck, Shoulder, and Chest Pain
Machado Douaihi, S. J., Waters, H.
The AAO Journal, 2025/06
192

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06
193

“I Feel Stuck:“ A Case Presentation on the Application of OMM to a Patient with Chronic Atypical Chest Pain After Pulmonary Coccidioidomycosis
Mayberry, M., Ural, E.
The AAO Journal, 2025/06
194

A Viscerosomatic Discovery: Unveiling a Case of Gastroparesis Disguised as Shoulder Pain
McKenna, T., Pfeifer, K., Wallace-Ross, J.
The AAO Journal, 2025/06
195

Exploring the Impact of Teaching Assistants on Student Learning in Osteopathic Manipulative Medicine (OMM) Laboratory Session: A Survey Study
Mehra, M., Ashkezari, A. D., Caron, E., Noto, P., Yao, S. C.
The AAO Journal, 2025/06
196

Evaluating the Efficacy of AI Note-Taking Software in Documenting Osteopathic Manipulative Medicine Treatment Encounters
Milius, M., Jurges, T., Pentlarge, J., Gabriel, D., Yang, N., Yadalla, S., Siddiqui, S., Bills, K., Barnhurst, N.
The AAO Journal, 2025/06
197

Assessing the Impact of Osteopathic Principles and Practice Teaching Assistants (OPP-TAs) at California Health Sciences University College of Osteopathic Medicine (CHSU-COM)
Miller, G., Pryor, J., Chun, L.
The AAO Journal, 2025/06
198

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06
199

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06
200

Die Wirksamkeit einer osteopathischen Behandlung auf das Schmerzempfinden von Frauen mit endometrioseassoziierten Schmerzen
(The effectiveness of osteopathic treatment on the pain perception of women with endometriosis-associated pain)
Boltz, A.
Unpublished MSc thesis, 2025/06
201

Comparing Measurements of the Carpal Tunnel and the Median Nerve Before and After Applying Osteopathic Manipulative Treatment: An Ultrasound-Guided Case Study
Nandedkar, T., Brown, S., Schneider, R., Rosten, C.
The AAO Journal, 2025/06
202

Osteopathic Manipulative Treatment (OMT) Techniques Utilized for Specific Post-COVID Symptoms Based on Physician Survey Results
Nawrocka, N., Baronos, A., Yao, S. C.
The AAO Journal, 2025/06
203

When it’s not about Ankyloglossia: A case of Osteopathic Manipulative Treatment for Newborn Breastfeeding Difficulties in the Absence of Restricted Labial or Lingual Frenula
Nixon, B., Waters, H.
The AAO Journal, 2025/06
204

Finding his Voice: A Case Report of the Utility of OMT in a Child with Global Delay
Petrillo, G., Keys, J.
The AAO Journal, 2025/06
205

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06
206

Osteopathic Manipulative Treatment in Cervical Dystonia Patients Treated with IncobotulinumtoxinA
Décarie, P., Chouinard, S., Venne, G.
International Journal of Osteopathic Medicine, 2025/06
207

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06
208

Short-Lever Assessment of Spinal Side-Bending
Sudweeks, K., McClendon, M., Khalil, F., Kania, A.
The AAO Journal, 2025/06
209

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06
210

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06
211

Management of Chronic Migraine in a 34-year-Old Obese Female
White, E., Johnson, R., Yu, X., Bardowell, A.
The AAO Journal, 2025/06
212

Osteopaths’ perspective and experiences of elite track and field athletes osteopathic treatments: A descriptive phenomenological study
Consorti, G., Fard, R., Odorisio, L., Cella, M.
Journal of Bodywork and Movement Therapies, 2025/06
213

Significant Improvement of Fibromyalgia Symptoms With Osteopathic Manipulative Treatment: A Case Report
Ansari, A. Z., Mokodanski, N. A., Ahmed, F., Fairooz, A., Hafeez, S.
Cureus, 2025/06
Free full text
214

Therapeutic efficacy of individual head orthoses in infants with positional plagiocephaly
Chhatwani, S., Degener, C., Rako, L., Kirschneck, C., Möhlhenrich, S. C., Danesh, G., Kelker, M.
Journal of Orofacial Orthopedics, 2025/06
Free full text
215

Impact of Academic Support Interventions on Failing First-Semester Medical Students
Chosie, K., Shults, R.
Cureus, 2025/06
Free full text
216

Osteopathic manipulation to increase lactation quantity: a prospective case series
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2025/06
Free full text
217

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/06
218

Response to Letter to the Editor “Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities” about the article “Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., & Arnal-Gómez, A. (2025). Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial. International Journal of Osteopathic Medicine, 56, 100761.”
Espí-López, G. V.
International Journal of Osteopathic Medicine, 2025/06
219

The Impact of Biological Sex, Medical School Background, and Geographic Location on Diversity in U.S. Neurosurgery Residency Programs
Fioletova, M., Perkinson, K. A., Nemani, M., Sees, J. P.
Cureus, 2025/06
Free full text
220

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/06
Free full text
221

Long-/Post-Covid - Eine Scoping-Review zu Chancen und Nutzen osteopathischer Behandlungen
(Long-/Post-Covid - A scoping review of the opportunities and benefits of osteopathic treatments)
Klemm, J.
Unpublished MSc thesis, 2025/06
222

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/06
Free full text
223

Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities
Nufi, E. P.
International Journal of Osteopathic Medicine, 2025/06
224

Einfluss einer osteopathischen Behandlung auf das subjektive Wohlbefinden, die Mobilität und die Leistungsfähigkeit der Rückenmuskulatur bei Sportlerinnen und Sportlern
(Influence of osteopathic treatment on the subjective well-being, mobility and performance of the back muscles of athletes)
Kott, V.
Unpublished MSc thesis, 2025/06
225

Osteoevidence: A User-Centric Database for Advancing Osteopathic Manipulative Medicine
Pollesel, A., Pollesel, G., Petrulaityte, A.
Medical Reference Services Quarterly, 2025/06
226

Scholar 12 longitudinal outcomes: osteopathic research development application to facilitate scholarly activity during the pandemic and beyond
Rowane, M. J., Thomas, K. A., Smith, T. M., Terrel, M. A., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/06
Free full text
227

Effekte der Osteopathie auf die HRV, die NRS und die Lebensqualität bei Patientinnen mit primärer Dysmenorrhoe: Eine integrative Fallserie
(Effects of Osteopathy on HRV, NRS, and Quality of Life in Patients with Primary Dysmenorrhea: An Integrative Case Series)
Markovics, M.
Unpublished MSc thesis, 2025/06
228

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text
229

The possibility of using osteopathic correction in the complex therapy of patients with chronic telogen hair loss
(Возможность применения остеопатической коррекции в комплексной терапии пациенток с хроническим телогеновым выпадением волос)
Belash, V. O., Garaz, E. G.
Russian Osteopathic Journal, 2025/06
230

Auswirkung osteopathischer Behandlungen schwangerer Frauen während der Schwangerschaft in Bezug auf die Kaiserschnittrate
(Effects of Osteopathic Treatments on Pregnant Women During Pregnancy in Relation to the Cesarean Section Rate)
Neuhold, H.
Unpublished MSc thesis, 2025/06
231

Ultrasound verification of the effect of osteopathic correction on the structural and functional state of the median nerve in carpal tunnel syndrome (pilot study
(Ультразвуковая объективизация влияния остеопатической коррекции на состояние срединного нерва при синдроме запястного канала (пилотное исследование)
Belyaev, A. F., Belomestnov, P. V., Volkonskaya, E. A.
Russian Osteopathic Journal, 2025/06
232

Оsteopathic treatment of supraorbital neuralgia in a child
(Остеопатическое лечение супраорбитальной невралгии у ребенка)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/06
233

Effect of osteopathic correction on urodynamic parameters in pregnant women with chronic pyelonephritis
(Влияние остеопатической коррекции на показатели уродинамики у беременных с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
234

Possibilities of including osteopathic methods of correction in the complex treatment of urolithiasis
(Возможность включения остеопатической коррекции в комплексное лечение мочекаменной болезни)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
235

Osteopathische Nachbehandlung alter offener Appendektomien und ihre Auswirkung auf chronische Rückenschmerzen – eine pragmatische, quasirandomisierte, kontrollierte Pilotstudie
(Effect of Osteopathic Treatment After Historical Open Appendectomy on Chronic Low Back Pain: A Pragmatic Quasi-Randomized Controlled Pilot Study)
Rottensteiner, M.
Unpublished MSc thesis, 2025/06
236

Personal brand of an osteopathic doctor as a promotion strategy in the market of medical services
(Личный бренд врача-остеопата как стратегия продвижения на рынке медицинских услуг)
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2025/06
237

Effekte einer osteopathischen Behandlung auf die Herzratenvariabilität bei Patientinnen mit Colitis Ulcerosa: Eine integrative Fallserie
(Effects of Osteopathic Treatment on Heart Rate Variability in Patients with Ulcerative Colitis: An Integrative Case Series)
Schabauer, O.
Unpublished MSc thesis, 2025/06
238

Efficacy and safety of musculoskeletal manipulations in elderly population with musculoskeletal disorders: a systematic review
Bagagiolo, D., Persiani, M., Cicchitti, L., Vismara, L., Bruini, I., Mauro, A., Buffone, F.
BMJ Open, 2025/06
239

Einfluss manueller osteopathischer Behandlung auf den Zeitpunkt des eigenständigen Trinkens der ausreichenden Trinkmenge im Vergleich zu Static Touch Interventionen
(Influence of Manual Osteopathic Treatment on the Time of Full Oral Feeding in Comparison with Static Touch Interventions)
Topf, C.
Unpublished MSc thesis, 2025/06
240

Einfluss einer einmaligen osteopathischen Behandlung auf Stabilität, Symmetrie und Sensomotorik von Kindern mit Angststörung oder ADHS
(Effect of a single osteopathic treatment on stability, symmetry and sensorimotor function in children with symptoms of an anxiety disorder or ADHD)
Wittig-Chronopoulos, M.
Unpublished MSc thesis, 2025/06
241

Die Auswirkung einer kranialen venösen Drainage auf die Konzentrationsleistung bei Personen im Alter von vierzig bis sechzig Jahren: eine randomisierte kontrollierte Studie
Wöckinger, M.
Unpublished MSc thesis, 2025/06
242

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06
243

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma-Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
244

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06
245

Técnicas de terapia manual no manejo da constipação funcional: uma revisão sistemática com metanálise
(Manual therapy techniques in the management of functional constipation: a systematic review with meta-analysis)
Nascimento, M. S.
Unpublished MSc thesis, 2025/05
246

Providing Palliative Care for Two: Managing Cancer-Related Pain During Pregnancy
Okonta, V., Kirkire, L., Schoen, M., Mesarwi, P., Skavinski, K.
Journal of Pain and Symptom Management, 2025/05
247

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/05
248

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text
249

Osteopathic Manipulative Treatment for Chronic Low Back Pain and Musculoskeletal Pain in Remote Underserved Populations: A Systematic Literature Review
Friedman, A., Sheth, R., Wallace-Ross, J.
Cureus, 2025/05
Free full text
250

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/05
Free full text
251

Effectiveness of Different Teaching Modalities in Human Gross Anatomy Education
Mooney, A., Thompson, N. E., Hoffmann, S.
Clinical Anatomy, 2025/05
252

Assessing Osteopathic Medical Students' Knowledge, Attitude, and Perspective on the Use of Assisted Reproductive Technologies (ART)
Patel, A., Capote, M. M., Manguvo, A., Mafuvadze, B.
Cureus, 2025/05
Free full text
253

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/05
254

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text
255

Effectiveness of osteopathic manual treatment in the elderly population: a scoping review of clinical evidence
Molinari, L., Mingrone, L., Novelli, E.
Journal of Osteopathic Medicine, 2025/05
Free full text
256

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2025/05
Free full text
257

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/05
Free full text
258

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/05
259

Potential impact of an osteopathic intervention for internationally adopted children with fetal alcohol spectrum disorder (FASD); a prospective case series
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., Aldecoa-Bilbao, V., García-Algar, Ó.
International Journal of Osteopathic Medicine, 2025/05
Free full text
260

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/05
261

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text
262

The Impact of a Simulated Intrauterine Device Insertion Clinic on Osteopathic Medical Students’ Knowledge, Attitude, and Self-Efficacy Regarding Intrauterine Devices
Betit, A. L., Kelly, L. P., Garg, R., Patel, P. G.
Cureus, 2025/05
263

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text
264

Towards a more equitable future: development, implementation, and evaluation of a novel e-course on racial disparities in pain management for medical students
Stensland, M., Maples, N., Sanford, E., Martinez, M.
BMC Medical Education, 2025/05
Free full text
265

Objective measurement of Cranial Rhythmic Impulse (CRI): visual analysis of an observational case series
Strada, M., Galli, M., Cattaneo, R.
Journal of Bodywork and Movement Therapies, 2025/05
266

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
267

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text
268

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text
269

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05
270

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text
271

Efficacy of Osteopathic Manipulative Treatment in Creating a Difference in Pain Levels for Patients With Localized Joint Pain: A Meta-Analysis of Randomized Controlled Trials
DeFrancisis, J. S., Vinarski, B. M., Abreu, M., Ibrahim, J., Hostoffer, R.
Cureus, 2025/04
Free full text
272

Virtual Escape Rooms in Anatomy Education: Case Studies from Two Institutions
Beger, A. W., Hannan, S., Patel, R., Sweeney, E. M.
Advances in Physiology Education, 2025/04
Free full text
273

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text
274

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text
275

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text
276

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2025/04
277

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text
278

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04
279

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/04
Free full text
280

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/04
Free full text
281

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/04
Free full text
282

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/04
Free full text
283

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/04
Free full text
284

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text
285

The Effect of Osteopathic Manipulative Treatment Adjunct on Stabilization Splint Treatment in Temporomandibular Joint Anterior Disc Displacement with Reduction Disorder: A Quantitative Analysis, Pilot Study
Aklar, A., Bal, B., Taşdelen, N., İnal, H. S., Ertaş, G.
Journal of Clinical Medicine, 2025/04
Free full text
286

Evaluation of the effectiveness of osteopathic treatment on the mother-newborn dyad in the event of painful breastfeeding in a maternity hospital despite the application of all usual aids: randomized interventional trial in two parallel arms without blinding
Elleau, C., Missmahl, C., Belcadi, W., Aurillac-Lavignolle, V., Sentilhes, L.
Frontiers in Nutrition, 2025/04
Free full text
287

Effect of osteopathic manipulation on pain, disability, range of motion and reposition sense in subjects with postural neck pain: a systematic review protocol
Hullumani, S., Raghumahanti, R., Qureshi, I., Ladkhedkar, P.
BMJ Open, 2025/04
Free full text
288

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text
289

Effectiveness of a program director for osteopathic medical education to support osteopathic recognition at a training site with multiple programs
Eilerman, A., Porter, C., Faherty, M., Zmuda, E.
Journal of Osteopathic Medicine, 2025/04
Free full text
290

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text
291

Lecture Capture, Transcripts, and Captioning in US Colleges of Osteopathic Medicine: Descriptive Cross-Sectional Survey
Khong, P., Holmes, D., Masoudian, B., Lund, G. C., Garwood, S.
Medical Science Educator, 2025/04
Free full text
292

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text
293

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text
294

Fostering Professionalism in Medical Education: the Common Ground Professionalism Initiative at Michigan State University College of Osteopathic Medicine
Jalaba, S., Ruger, K., Kerver, H.
Medical Science Educator, 2025/04
Free full text
295

The Effectiveness of Osteopathic Correction in the Complex Rehabilitation of Patients with Temporomandibular Joint Dysfunction
Makichyan, T., Gusakova, E., Khabadze, Z., Sarkisian, A.
Georgian Medical News, 2025/04
Free full text
296

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
D&rsquo, Alessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text
297

The development of the National Council for Osteopathic Research - Research Network (NCOR-RN): A qualitative focus group study of osteopaths’ views
Bailey, D., Fawkes, C., Carnes, D., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2025/03
298

The assessment of point-of-care ultrasound (POCUS) in residency: the benefits of a four-year longitudinally integrated curriculum
Le, D. Q., Scarpulla, M., Lam, H., Kern, J., Vroegop, S., Yaeger, J., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2025/03
Free full text
299

Effekt von osteopathischen Behandlungen während interdisziplinärem Gewichtsreduktionskonzept von Patienten mit Adipositas Grad 1 -3
(Effect of Osteopathic Treatments During an Interdisciplinary Weight Reduction Program in Patients with Grade 1–3 Obesity)
Brenner, M.
Unpublished MSc thesis, 2025/03
300

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text
301

Assessing the effects of manual therapy on pain in patients living with Persistent Non-Specific Low Back Pain (PNSLBP): Which evaluation criteria and measurement tools used in randomised controlled clinical trials? A systematic review
Bilhaut, A., Olivier, A.H., Draper-Rodi, J., Cretual, A., Ménard, M.
International Journal of Osteopathic Medicine, 2025/03
302

Exploring Trismus Management in Australia: A Mixed Methods Evaluation of Surveys and Interviews With Health Professionals
Charters, E., Venchiarutti, R., Dunn, M., Clark, J.
Head & Neck, 2025/03
303

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03
304

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text
305

Changes in Matches into Surgical Residencies and Fellowships Following the ACGME Merger
Soliman, S. S., Andrews, G., Emara, S., Watkins-Granville, N., Podwójniak, A., Hasan, I., Stuti, J., Brotman, A.
Journal of Surgical Education, 2025/03
Free full text
306

„Du lebst und stirbst durch mich“: Das Zwerchfell im osteopathischen Kontext
(“You live and die through me“: the diaphragm in an osteopathic context)
Engel, M.
Osteopathische Medizin, 2025/03
307

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/03
Free full text
308

Exploring the Cost and Access Gap Between Osteopathic and Allopathic Medical Students When Applying for General Surgery Fourth-Year Away Rotations
Moza, M. M., Guarneri, B. D., Morrison, L., Allgood, L.
Cureus, 2025/03
Free full text
309

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/03
310

Increase in the Number of Medical Schools in the United States and Its Potential Adverse Ramifications for Urology Residency Applicants
Donato, U. M., Ebedes, D. M., Nelwan, D., Imam, A., Patel, T.
Cureus, 2025/03
Free full text
311

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/03
Free full text
312

Osteopathic Manipulative Treatment of the Ankle-Foot Complex in Individuals with Limited Dorsiflexion: Study Protocol for a Randomized Crossover Clinical Trial
Loures de Paula, A., Castro, R. Q., Souza, H. C., de Castro Moreira, B., Moreira Baião, I. C., Schmitz Correa, C. P., Felício, D. C., Fonseca, D. S.
International Journal of Osteopathic Medicine, 2025/03
313

Osteopathische Behandlung therapieresistenter Schmerzen: Chronisch abdominaler Schmerz, eingeschränkte Atmung und Unverträglichkeit von Schmerzmitteln bei Zustand nach Colon-ascendens-Karzinom
(Osteopathic treatment of therapy-resistant pain: Chronic abdominal pain, restricted breathing and intolerance to painkillers in the condition after ascending colon cancer)
Geilgens, A., Repik, I.
Osteopathische Medizin, 2025/03
314

Understanding COMLEX-USA Level-1 as a Pass/Fail examination: impact and opportunities
Gerhardson, A., Efurd, M., Sexton, P., Sefcik, D.
Journal of Osteopathic Medicine, 2025/03
Free full text
315

An Innovative Osteopathic Curriculum for Allopathic and Osteopathic Family Medicine Residents
Price, J. W.
The AAO Journal, 2025/03
316

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text
317

Effect of osteopathic correction on the manifestations of postcholecystectomy syndrome
(Влияние остеопатической коррекции на проявления постхолецистэктомического синдрома)
Bibikov, A. A., Nenashkina, E. N., Oreshko, A. Y.
Russian Osteopathic Journal, 2025/03
318

Possibility of using manual therapy and osteopathic correction for delayed speech and motor development in children
(Возможности применения мануальной терапии и остеопатической коррекции при задержке речевого и моторного развития у детей)
Bobko, A. Y., Bobko, Y. N., Adulas, E. I., Mizonova, I. B., Bulina, O. V., Suslova, G. A.
Russian Osteopathic Journal, 2025/03
319

Dynamics of osteopathic status in patients with chronic tonsillitis during complex treatment with inclusion of osteopathic correction
(Динамика остеопатического статуса у пациентов с хроническим тонзиллитом при комплексном лечении с включением остеопатической коррекции)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushk, S. A.
Russian Osteopathic Journal, 2025/03
320

Non-medicamentous methods in conservative treatment and preoperative preparation of patients with gonarthritis (literature review
(Немедикаментозные методы в консервативном лечении и предоперационной подготовке пациентов с гонартритом (обзор литературы)
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/03
321

Osteopathic correction as part of complex treatment of patients with uterine form of infertility
(Остеопатическая коррекция в составе комплексного лечения пациенток с маточной формой бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/03
322

Application of osteopathic correction in complex therapy of patients with varicose veins of the lower limbs
(Применение остеопатической коррекции в комплексной терапии пациенток с варикозной болезнью нижних конечностей)
Belash, V. O., Usenko, K. P.
Russian Osteopathic Journal, 2025/03
323

Функции диафрагмы и их нарушение при искусственной вентиляции легких (обзор литературы)
Tolmachev, K. M., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/03
324

DO (under) representation in US guideline development: an investigation of guideline authors from 2021-2023
Amendolara, A. B., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, A. M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2025/03
Free full text
325

Appraisal of Sexual Education Curriculum in Secondary Schools With Inclusion of Practical Implications and Evaluation, Based on Rural-Urban Residence
Betit, A. L., Kennedy, C.
Cureus, 2025/03
Free full text
326

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03
327

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/03
328

503 A Closer Look at Pathology Education in Osteopathic Medical Schools: Data from 2021 to 2024
Preston, P., Herman, M., Berry, A., Robinson, M., Kowalski, P.
Laboratory Investigation, 2025/03
329

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text
330

A national survey of osteopaths' conceptions of practice in France: structural validity of the Osteo-TAQfr and the tendency toward technical rationality
Thomson, O. P., Treffel, L., Wagner, A., Jacquot, E., Draper-Rodi, J., Morin, C., Vaughan, B.
BMC Health Services Research, 2025/03
331

Gender Health Gap und die Rolle der Osteopathie in der Frauenheilkunde
(Gender Health Gap and the role of osteopathy in gynecology)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
332

Die Milz
(The Spleen)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
333

Track and field coaches' perspective and experiences of including osteopaths in shared management of elite athletes: A descriptive phenomenological study
Fard, R., Cella, M., Odorisio, L., Consorti, G.
Journal of Bodywork and Movement Therapies, 2025/03
334

Kommunikation und professionelle Gesprächsführung in der osteopathischen Praxis
(Communication and professional conversation techniques in the osteopathic practice)
Stachowski, A.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
335

Formen der funktionellen Harninkontinenz bei Kindern
(Forms of functional urinary incontinence in children)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
336

Investigating trends in orthopedic surgery match for osteopathic and allopathic graduates post-single accreditation transition
Megafu, M., Guerrero, O. D.
Journal of Osteopathic Medicine, 2025/02
Free full text
337

Practitioner characteristics of osteopaths who treat pregnant women and children: An Australasian perspective from two practice-based research networks
Steel, A., Draper-Rodi, J., Fleischmann, M., Morin, C., Ferreira, A. P., Vaughan, B., Orrock, P.
Complementary Therapies in Clinical Practice, 2025/02
338

Formation of myofаscial pain syndrome and its correction in patients with tension headache
Vesnin, A. V., Tovazhnianska, O. L.
Journal of V. N. Karazin Kharkiv National University. Series 'Medicine', 2025/02
339

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text
340

Comparing cranial suture interdigitation in humans and non-human primates: unearthing links to osteopathic cranial concept
Blumer, J., Arney, I., Hardin, A., Nichols, M., Arsenault, L., Petrucci, J.
Journal of Osteopathic Medicine, 2025/02
Free full text
341

Analysis of self-reported confidence in independent prescribing among osteopathic medical graduating seniors
Eldeeb, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
342

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
343

Dr. William Garner Sutherland (1873-1954): The Founder of Cranial Osteopathy
Childs, B., Hammes, C.
Cureus, 2025/02
Free full text
344

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text
345

Effects of manual osteopathic interventions on psychometric and psychophysiological indicators of anxiety, depression and stress in adults: a systematic review and meta-analysis of randomised controlled trials
Gordon, T. C., Hope-Bell, J., Draper-Rodi, J., MacMillan, A., Miller, D., Edwards, D. J.
BMJ Open, 2025/02
Free full text
346

Exploring the Impact of Osteopathic Manipulative Treatment on Chronic Migraine Relief: A Case Study
Lahlou, Y., Aamir, M., Shadiack, V.
Cureus, 2025/02
Free full text
347

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text
348

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/02
Free full text
349

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text
350

Perspectives of osteopathic medical students on preclinical urology exposure: a single institution cross-sectional survey
Wong, R., Mayrovitz, H. N.
Journal of Osteopathic Medicine, 2025/02
351

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text
352

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
353

Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/02
Free full text
354

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text
355

Diagnosis and Treatment of Thoracic Outlet Syndrome in an Elderly Male Patient: A Case Report and Protocol Evaluation
Dale, J. L., Sood, H.
Cureus, 2025/02
Free full text
356

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text
357

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text
358

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/02
Free full text
359

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text
360

Specificity of cranial cutaneous manipulations in modulating autonomic nervous system responses and physiological oscillations: A controlled study
Keller, M., Perlitz, V., Pelz, H., Borik, S., Repik, I., Geilgens, A., Cotuk, B., Müller, G., Mathiak, K., Mayer, J.
PLoS ONE, 2025/02
Free full text
361

Trends in osteopathic medical education: a scoping review
Hoskins, K., Montgomery, M., Griffith, A., Pollard, H., Orr-Roderick, D., Schmick, D., Strausman, J., Wade, S., Robertson, M., DeArmond, M.
Journal of Osteopathic Medicine, 2025/02
Free full text
362

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text
363

Visceral manipulation intervention in functional dyspepsia with or without gastroesophageal reflux disease: a systematic review.
Achmad, A., Manaf, H.
International Journal of Public Health Science, 2025/02
Free full text
364

Approche neuroprotectrice de l’ostéopathie chez les grands prématurés : tolérance, sécurité et bénéfices potentiels
(Neuroprotective approach of osteopathy in very preterm infants: tolerance, safety, and potential benefits)
O'Connor, S.
Unpublished PhD thesis, 2025/01
Free full text
365

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text
366

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
367

Gedanken zur Behandlung von Cochlea-Implantat-Trägern
(Thoughts on the treatment of cochlear implant users)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
368

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
369

Foot and ankle fellowship-trained osteopathic orthopaedic surgeons: a review, analysis, and understanding of current trends
Henry, J. P., Partan, M. J., Chen, K. M., Cohn, R. M., Bitterman, A. D.
Journal of Osteopathic Medicine, 2025/01
Free full text
370

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text
371

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text
372

Dr. William Garner Sutherland: The Man Who Changed Osteopathy Forever
Sharath, H. V., Phansopkar, P., Qureshi, M. I., Raghuveer, R., Kaur, G.
Cureus, 2025/01
Free full text
373

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
BMC Pediatrics, 2025/01
Free full text
374

Neuroimaging model of visceral manipulation in awake rat
Cramer, S. R., Han, X., Chan, D. C. Y., Neuberger, T., Zhang, N.
The Journal of Neuroscience, 2025/01
375

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text
376

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text
377

Osteopathic Manipulative Treatment: A Safe and Feasible Adjunct in Sickle Cell Disease Pain Management
Brown, A., Goubeaux, D., Jacob, S. A., Belsky, J. A.
Pediatric Blood & Cancer, 2025/01
378

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
379

The Effect of Osteopathic Visceral Manipulation on Quality of Life and Postural Stability in Women with Endometriosis and Women with Pelvic Organ Prolapse: A Non-Controlled Before-After Clinical Study
Wójcik, M., Kampioni, M., Hudáková, Z., Siatkowski, I., Kędzia, W., Jarząbek-Bielecka, G.
Journal of Clinical Medicine, 2025/01
Free full text
380

Electronic health care record for objective structured clinical examination stations at Philadelphia College of Osteopathic Medicine School of Pharmacy Georgia Campus during 2022-2023 academic year
Alhaddad, G., Saade, R., Najafabadi, I. K.
American Journal of Health-System Pharmacy, 2025/01
381

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text
382

Evaluation of an Osteopathic Manipulative Medicine Curriculum for Pediatric Residents
LeMay, M., Newhall, L.
Academic Pediatrics, 2025/01
383

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01
384

Shifting Perspectives: Assessing Knowledge and Beliefs in Harm Reduction Strategies Among Future Healthcare Professionals - H.E.R.O. Harm Reduction and Opioid Education
Hamilton, M. E., Brian, M., Hill, S., Hurst, T.
American Journal of Health-System Pharmacy, 2025/01
385

Resident Perceptions of Migraine Management and Interventions to Improve Care
Malone, L. I., Kelley, K.
American Journal of Health-System Pharmacy, 2025/01
386

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text
387

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
388

Resolution of Chronic Coccydynia after Osteopathic Manipulative Treatment: A Case Report.
Valdés, D., Sherrington, M., Waters, L. M.
Osteopathic Family Physician, 2024/9
389

Use of Osteopathic Manipulative Treatment for the Management of Pectus Excavatum: A Single Case Study
Lin, Z. X., Perez, A., Volokitin, M.
Cureus, 2024/5
Free full text
390

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text
391

Osteopathic medical students' use of a customized mobile app to supplement ECG lectures for examinations
Zumwalt, J.
Unpublished PhD thesis, 2024/12
392

Osteopathic Treatment of a person with Arnold-Chiari Malformation and Syringomyelia: a case report
Cases-Solé, R., Varillas-Delgado, D., Trinidad-Cascudo, F., Pino-Tamayo, M. C., García-Algar, O.
International Journal of Osteopathic Medicine, 2024/12
393

Is visceral osteopathy therapy effective? A systematic review and meta-analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Esteban-Tarcaya, G., Mamud-Meroni, L., Jiménez-del-Barrio, S.
International Journal of Osteopathic Medicine, 2024/12
394

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text
395

“Disproportionate Olympic Rings” – the usage of a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain by osteopaths in Aotearoa/New Zealand– A qualitative study
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Fairs, E., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/12
396

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
397

Characteristics of the practice of New Zealand osteopaths who manage patients with chronic pain
McIntyre, C., Draper-Rodi, J., Antunes Ferreira, A. P., Muddle, L., McLeod, G. A., Sampath, K. K., Sinderholm Sposato, N., Vaughan, B.
Pain Management, 2024/12
398

Physiological Mechanisms Underlying the Primary Respiratory Mechanism (PRM) and Cranial Rhythmic Impulse (CRI) in Osteopathy: A Systematic Review
Mériaux, F., Stubbe, L., Guyon, A.
Healthcare, 2024/12
Free full text
399

Osteopathic health care in aged care facilities: The experience of practitioners in an emerging practice setting
Amorim, M., Bennett, J., McGarry, D., Moore, B., Orrock, P., Whitton, L., Dullard, S.
Australasian Journal on Ageing, 2024/12
Free full text
400

Treatment of migraine with aura with osteopathic manipulative treatment: a case report with renewed perspectives
Babek, N., Fiechter, C., Caretti, R., Phinney, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
401

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text
402

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text
403

An appraisal of neuroimmune changes and potential benefits of Osteopathic Manipulative Treatment integration with therapeutic management of Post COVID-19 Condition: a literature review
Senigagliesi, F., Scialla, S., Marasco, M. L.
International Journal of Osteopathic Medicine, 2024/12
404

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text
405

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12
406

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text
407

Osteopathische Behandlung radikulärer Schmerzen
(Osteopathic treatment of radicular pain)
Beckmann, U.
Osteopathische Medizin, 2024/12
408

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12
409

Evaluating the Information Quality of YouTube Videos on Manual Medicine/Therapy
Is, E. E., Tarihci Cakmak, E., Damla Korkmaz, M.
International Journal of Osteopathic Medicine, 2024/12
410

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität – Teil 2: Ergebnisse der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability - Part 2: Results of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/12
411

Underrepresentation of Osteopathic Physicians in the Development of Medical Guidelines
Amendolara, A., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2024/12
412

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12
413

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12
414

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12
415

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12
416

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12
417

Assessing the Role of Osteopathic Medical Education on Community Health Literacy Interventions Pilot Study
Good, C., McClain, E.
Journal of Osteopathic Medicine, 2024/12
418

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12
419

“Limitations of Life:” A Mixed Methods Survey Exploring Osteopathic Medical Students’ Perspectives on Reasons Preventing them from Practicing In Rural Communities
Haque, N., Richardson, C.
Journal of Osteopathic Medicine, 2024/12
420

Perception of Osteopathic Medicine in a Rural Clinic in Peru
Hovetter, K., Henke, C., Lopes, K., Berger, M., Boswell, K., Kandil, F., Ridpath, L., Waddell, M., Schmidt, D.
Journal of Osteopathic Medicine, 2024/12
421

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12
422

Promoting the Understanding Of Prerequisites, Training, Career Opportunities, and Practice Philosophy of Osteopathic Physicians Amongst Students in the Southeastern U.S.
Iyer, H., Saravanan, S., Oquendo, G., Zarandy, J., Roberts, M.
Journal of Osteopathic Medicine, 2024/12
423

Trends and Outcomes in Residency Matches: Assessing the Post-Merger Landscape for DO and MD Graduates
Jerman, H., Yebernetsky, K. E., Wilson, S.M. T., Rosmarin, S., Divito, C. B.
Journal of Osteopathic Medicine, 2024/12
424

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12
425

Multifaceted Therapeutic Approaches for the Management of Dyspareunia: A Narrative Review
Rastogi, M., Deka, K., Krishnan, S., Narayan, A., Nayak, M. M., Kumar, K. V.
The Open Public Health Journal, 2024/12
Free full text
426

Assessing the Role of Pronoun Competency Training in the Expansion of Transgender and Gender Diverse Curriculum in Undergraduate Medical Education
Morgan, R., Buckley, S., Scotten, M.
Journal of Osteopathic Medicine, 2024/12
427

Exploring Attitudes Towards Osteopathic Medicine in First and Second Year Osteopathic Medical Students Following Osteopathic Manipulative Medicine
Neiman, N., de Jesus, A., Zeller, A. M.
Journal of Osteopathic Medicine, 2024/12
428

Assessing the Potential Role for Using Artificial Intelligence (AI) in Osteopathic Medical Students Teaching and Learning
Patel, N., Martin, P., Benmerzouga, I.
Journal of Osteopathic Medicine, 2024/12
429

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12
430

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12
431

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12
432

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12
433

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2024/12
Free full text
434

Using Osteopathic Manipulative Therapy to Treat Irritable Bowel Syndrome and Severe Refractory Gastroesophageal Reflux Disease: A Case Report
Johnson, T., Jahnke, A. R., Reindel, K.
Cureus, 2024/12
Free full text
435

Osteopathic correction in the complex treatment of patients with panic disorder
(Остеопатическая коррекция в комплексном лечении пациенток с паническим расстройством)
Adamasova, Y. V., Belash, V. O.
Russian Osteopathic Journal, 2024/12
436

The influence of osteopathic correction on the functional state of volleyball athletes
(Влияние остеопатической коррекции на функциональное состояние спортсменов-волейболистов)
Alukaev, M. I., Ahmetzianov, T. Z., Potekhina, Y. P., Nenashkina, E. N., Yanushanets, O. I.
Russian Osteopathic Journal, 2024/12
437

Development of the skill of dosed pressure in doctors in the process of professional retraining in the speciality «Osteopathy»
(Развитие навыка дозированного давления у врачей в процессе профессиональной переподготовки по специальности «Остеопатия»)
Boyarinov, V. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/12
438

Manual medical technologies in complex treatment and rehabilitation of patients with primary osteoarthritis (literature review
(Мануальные медицинские технологии в комплексном лечении и реабилитации пациентов с первичным остеоартритом (обзор литературы)
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Gavrilova, T. A.
Russian Osteopathic Journal, 2024/12
439

The possibility of using osteopathic correction in the complex treatment of patient with tinnitus
(Возможность применения остеопатической коррекции в комплексном лечении пациента с тиннитусом)
Revina, M. B.
Russian Osteopathic Journal, 2024/12
440

Osteopathic correction as part of complex treatment of patients with irritable bowel syndrome
(Остеопатическая коррекция в составе комплексного лечения пациентов с синдромом раздраженного кишечника)
Yarysheva, Y. V., Dmitriev, A. A., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/12
441

The Effect of Osteopathic Manipulative Treatment on Acute Post COVID-19 Anosmia and Ageusia Symptoms: A Case Report
Mehra, M., Companion, N., Yao, S. C., Ventimiglia, M.
The AAO Journal, 2024/12
442

Uso do tratamento manipulativo osteopático em lactentes submetidos a ventilação mecânica e falha de extubação
(Use of osteopathic manipulative treatment in infants undergoing mechanical ventilation and extubation failure)
da Cunha, A. A.
Unpublished MSc thesis, 2024/12
Free full text
443

Diagnosing and treating upper back pain: insights from New Zealand’s manipulative physiotherapists and osteopaths
Kovanur Sampath, K., Smith, T., Belcher, S., Farrell, G., Fryer, G., Vaughan, B., Moran, R.
Journal of Manual & Manipulative Therapy, 2024/12
444

Characteristics, opportunities, and challenges of osteopathy (COCO) in the perceptions of osteopaths in Germany, Austria, and Switzerland: a metasynthesis
Manschel, J., Porthun, J., Beuckels, J. M., Martin, D.
European Journal of Medical Research, 2024/12
Free full text
445

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text
446

Das Menschenbild in der Osteopathie. Wie Osteopath*innen den Menschen sehen. Eine qualitative Studie
Fuchsluger, M.
unpublished MSc thesis, 2024/12
447

A Quantitative Program Evaluation of Restorative Justice Practices at United States Medical Schools
Harrison Schulman, J.
Unpublished MSc thesis, 2024/12
448

Osteopathie bei Personen mit einem Ehlers-Danlos-Syndrom - exemplarisch cEDS. Eine Einzelfallstudie
(Osteopathy for people with Ehlers-Danlos syndrome - exemplary cEDS. A single case study)
Eggert, M.H.
Unpublished MSc thesis, 2024/11
449

The use of respiratory patient reported outcome measures (PROMs) in the management of COPD: Perceptions of Australian osteopaths
Engel, R., Baxter, D., Muddle, L., Vaughan, B., Grace, S.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
450

Das Menschenbild in der Osteopathie Wie Osteopath*innen den Menschen sehen. Eine qualitative Studie
(The Human Image in Osteopathy: Osteopaths' Perspectives on the Human Being. A Qualitative Study)
Fuchsluger, M.
Unpublished MSc thesis, 2024/11
Free full text
451

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
452

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11
453

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text
454

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11
455

Applying an osteopathic intervention to improve mild to moderate mental health symptoms: a mixed-methods feasibility randomised trial
Hope-Bell, J., Draper-Rodi, J., Edwards, D. J.
Chiropractic & Manual Therapies, 2024/11
Free full text
456

Enhancing Clinical Skills Through Virtual Reality: A Study on 12-Lead Electrocardiogram Placement in Medical Education
Olayeye, K., Oviawe, E.
Cureus, 2024/11
Free full text
457

Einfluss osteopathischer Interventionen auf den Krankheitsverlauf und deren Auswirkung auf die gesundheitsbezogene Lebensqualität von pädiatrischem Morbus Crohn: Eine Einzelfallstudie
(Influence of osteopathic interventions on disease progression and its impact on health-related quality of life in pediatric Crohn's disease: a single-case study)
Vollmer, A.
Unpublished MSc thesis, 2024/11
458

Effizienz einer osteopathischen Intervention des Diaphragma bei Betroffenen mit Amyotropher Lateralsklerose (ALS)
(Efficacy of osteopathic intervention through the Diaphragm technique in ALS patients)
Wendel, J.
Unpublished MSc thesis, 2024/11
459

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text
460

Therapeutic approaches and conceptions of practice of osteopaths in Australia - a national cross-sectional study and exploratory factor analysis of the Osteo-TAQ
Thomson, O. P., McLeod, G. A., Fleischmann, M., Vaughan, B.
BMC Health Services Research, 2024/11
Free full text
461

Pelvic joint stiffness and fear of falling in patients over 75 years of age: a prospective cohort study of 100 patients
Laizeau, C., Jochmans, S., Aufaure, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
462

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/11
463

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text
464

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text
465

Building an evidence base for osteopathy: Trials and tensions. A qualitative study of the experience of clinicians engaging in research
Grace, S., Engel, R., Vogel, S., Ahrens, G., Barclay, K., Guy, C., Lowe, C., McCormack, T., Paranthoiene, J., Carnes, D.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
466

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11
467

Management of Medial Tibial Stress Syndrome with osteopathic manipulative treatment in a basketball player: Case Report
Colli, D., Tarantino, A. G., Bergna, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2024/10
468

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10
469

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10
470

Kann osteopathische Behandlung der Patella Knieschmerzen, Beweglichkeit und Lebensqualität verbessern? Eine randomisierte kontrollierte Studie
(Can Osteopathic Treatment of the Patella Improve Knee Pain, Mobility, and Quality of Life? A Randomized Controlled Study)
Dierenbach, R.
Unpublished MSc thesis, 2024/10
471

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text
472

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text
473

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text
474

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10
475

Effectiveness of osteopathic craniosacral techniques: a meta-analysis
Amendolara, A., Sheppert, A., Powers, R., Payne, A., Stacey, S., Sant, D.
Frontiers in Medicine, 2024/10
Free full text
476

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text
477

Using Osteopathic Medical School Institutional Data to Establish the Correlation Between Academic Performance and First-Time Board Pass Rates to Develop Academic Interventions for Students at Risk of First Board Failure
Chosie, K.
Cureus, 2024/10
Free full text
478

The Transformative Care Continuum: implementing an accelerated pathway that addresses the new roles of the family medicine physician
Chrisman-Khawam, L., Snyder, S., Tyler, C., Harley, D., Davidson, E., Anthes, L., Casapulla, S.
Medical Education Online, 2024/10
Free full text
479

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text
480

Geographical Distribution and Trends Analysis of Osteopathic General Surgery Residents
Ernst, M. D., Alexander, V. S., Wong, R., Berg, N., Roberts, H., Vogel, A. D., Burns, J. B., Conrad-Schnetz, K.
Cureus, 2024/10
Free full text
481

Effects of Osteopathic Manipulative Treatment on Rare Diseases: A Case Report on Gordon Syndrome
Johnson, T., Waters, H. B.
Cureus, 2024/10
Free full text
482

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/10
483

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text
484

Novel Diagnosis and Treatment for Neurogenic Thoracic Outlet Syndrome
Tafler, L., Borkowski, S., Javaid, G., Gandolfo, D., Kleyn, D.
Cureus, 2024/10
Free full text
485

Elite Track and Field Athletes’ Perspective and Experiences of Osteopathic Treatments: A Descriptive Phenomenological Study
Cella, M., Consorti, G., Odorisio, L., Fard, R.
Journal of Bodywork and Movement Therapies, 2024/10
486

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text
487

A Retrospective Study of Virtual Hospital Experiential Learning Across Clerkship and Pre-clerkship Doctor of Osteopathic Medicine Students at a Medical School Based in the United States
Kersh, L., Sciuva, A., Shaw, J.
Cureus, 2024/10
Free full text
488

Verbesserung der Schlafqualität während der Wechseljahre - Ein osteopathischer Ansatz
(Sleep quality improvement during Perimenopause – an osteopathic approach)
Schellhorn, S.
Unpublished MSc thesis, 2024/10
489

Effect of electromagnetic stimulation combined with visceral manipulation on stress urinary incontinence in postmenopausal women: A randomized controlled trial
Mohamed, D. M. A., Kamel, D. M., El-Moatasem, A. M., Ali, E. A., Radwan, M. A., Ahmed, S. M.
Journal of Bodywork and Movement Therapies, 2024/10
490

Evaluating the Impact of Direct, Direct Video, and Indirect Video Laryngoscopy Training on the Proficiency of Medical Students in Performing Direct Laryngoscopy: A High-Fidelity Manikin-Based Assessment
Moriarty, S. E., Perera, I. R., Sabbagh, M., Yeckley, M., Carpio, P., Hoodfar, A., LePera, A., Anandakrishnan, R., Daniels, T., Martin, R., Looney, J., Gittings, K., Edwards, W., Rawlins, F.
Cureus, 2024/10
Free full text
491

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10
492

An Osteopathic Approach to Foot Drop: A Case Report of Posterior Fibular Head
Volokitin, M., Libman, A. E., Milani, S., Banihashem, M., Ayon, S.
Cureus, 2024/10
Free full text
493

Impacto do tratamento manipulativo osteopático nos músculos faciais de crianças com sequência de Moebius
(Impact of osteopathic manipulative treatment in children with congenital facial paralysis)
Amoroso Borges, B. L.
Unpublished Dissertation, 2024/10
Free full text
494

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10
495

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text
496

Paradigmata der (ursprünglichen) Osteopathie
(Paradigms of (original) osteopathy)
Engel, M.
Osteopathische Medizin, 2024/09
497

Die Bedeutung des osteopathischen Behandelns für Kinder nach einer Frühgeburt: Eine Befragung von Kinderosteopath*innen
(The importance of osteopathic treatment for children after premature birth: a survey of pediatric osteopaths)
Hackner, L., Belz, S., Esch, S.
Osteopathische Medizin, 2024/09
498

Efficacy of ankle mobilization on postural control in older people: A systematic review with meta-analysis
Hernández-Guillén, D., García-Gomariz, C., Roig-Casasús, S., Díaz-Díaz, B., Domínguez-Navarro, F., Pérez-Maletzki, J., Blasco, J.M.
International Journal of Osteopathic Medicine, 2024/09
Free full text
499

Heilungshindernis bei klaffender Tube – ein Fallbericht
(Obstacle to healing a patulous Eustachian tube - a case report)
Kaltenbrunner, U.
Osteopathische Medizin, 2024/09
500

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität: Teil 1 – Ziele, Material und Methoden der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability: Part 1 - Objectives, material and methods of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/09
501

Perceived benefits and limitations of game-based simulation education by osteopathy students in early clinical training: A preliminary mixed methods study
Mhadhbi, H., Horta, L. M., Ims, J., Draper-Rodi, J., Mansfield, H., Shaw, R., Rinne, S., Cleland Silva, T., Metsälä, E., Ménard, M.
International Journal of Osteopathic Medicine, 2024/09
502

ADHS bei Erwachsenen in der osteopathischen Praxis
(ADHD in adults in the osteopathic practice)
Plathner, M.
Osteopathische Medizin, 2024/09
503

Development and adaptation of the Osteopaths' Therapeutic Approaches Questionnaire (Osteo-TAQ) for the Australian osteopathic profession - A cognitive interview study
Thomson, O. P., McLeod, G. A., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2024/09
504

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09
505

Young Doctors Program-Colorado: An Elective Elementary School Program to Improve Health Literacy, Utilization of the Healthcare System, and Osteopathic Awareness
Sposet, S., Fabich, R., McEchron, M.
Medical Science Educator, 2024/09
Free full text
506

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
507

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
508

Behandlung des männlichen chronischen Beckenschmerzsyndroms (CBSS)
(Treatment of male chronic pelvic pain syndrome (CPPS))
Switters, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
509

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text
510

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text
511

Positional plagiocephaly: results of the osteopathic treatment of 424 infants. An observational retrospective cohort study
Panza, R., Piarulli, F., Rizzo, V., Schettini, F., Baldassarre, M. E., Di Lorenzo, A., Tafuri, S., Laforgia, N.
Italian Journal of Pediatrics, 2024/09
Free full text
512

Osteopathic Approach to Proximal Hamstring Tendinopathy-related Sciatic Nerve Entrapment (PHTrSNE): Case Report
Hermoso, J., Bailey, G., Bhatti, K., Sneed, J.
The AAO Journal, 2024/09
513

Osteopathic Considerations in the Medical Treatment of a Patient with COVID-Related Respiratory Distress
Yang, Y., Carnes, M., Kingery, J., Stiles, E.
The AAO Journal, 2024/09
514

Evaluation of the clinical effectiveness of osteopathic gallbladder drainage techniques
(Оценка клинической результативности остеопатических техник дренирования желчного пузыря)
Belash, V. O., Zavadsky, E. Y., Zueva, A. I.
Russian Osteopathic Journal, 2024/09
515

Medical and pharmacy students' perceptions of their IPE and cultural competencies following an innovative course
Addo-Atuah, J., Gardere, J.
Pharmacy Education, 2024/09
516

Influence of a single osteopathic procedure on the regulatory processes of the body of premature infants (pilot study
(Влияние однократной процедуры остеопатической коррекции на регуляторные процессы организма недоношенных детей (пилотное исследование)
Belyaev, A. F., Yurchenko, M. S., Kharkovskaya, T. S., Kurleeva, T. Y., Akhtanina, E. A.
Russian Osteopathic Journal, 2024/09
517

Morphofunctional indicators of the body students of the medical university
(Морфофункциональные показатели организма студентов медицинского университета)
Kalyuzhny, E. A., Bogomolova, E. S., Mukhina, I. V., Galova, E. A., Basurov, V. A., Nazarova, N. A.
Russian Osteopathic Journal, 2024/09
518

Characteristics of perception channels of doctors and their changes in the process of professional retraining in the discipline of «Osteopathy»
(Характеристики каналов восприятия у врачей и их изменения в процессе профессиональной переподготовки по дисциплине «Остеопатия»)
Sokolova, I. V., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/09
519

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text
520

Chronic Rhinosinusitis Management: A Narrative Review Comparing Interventional Treatment With Osteopathic Manipulation
Klover, C. R., Gorantla, V. R.
Cureus, 2024/09
Free full text
521

„Wie der Ast gebogen wird, so wächst der Baum“
Teichmann, P.
Skeptiker, 2024/09
522

Available Treatments and Adjunctive Therapies for Polycystic Ovarian Syndrome (PCOS) Patients of Reproductive Age: A Scoping Review
Cochran, L., Nadolny, R., Garcia, K., Kluglein, K. A., Yagoda, A., Gandhi, P., Dressel, J., Prol, B., Peralta, R., Shipp, A., Costin, J. M.
Cureus, 2024/09
Free full text
523

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text
524

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text
525

Investigating the safety and feasibility of osteopathic manipulative medicine in hospitalized children and adolescent young adults with cancer
Belsky, J. A., Brown, A. M.
Journal of Osteopathic Medicine, 2024/09
Free full text
526

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text
527

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text
528

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text
529

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09
530

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text
531

A Test of Reliability: Cranial Rhythmic Impulse for Distant Diagnoses
Alvarez, L. A., Cook, A. C., Sweeney, C. P., Walter, M. R., South, S. C., Myers, N., Boesler, D., Ma, S., Thomas, K., Quinn, T. A.
Cureus, 2024/08
Free full text
532

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08
533

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text
534

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text
535

Evaluation of the Effect of Nutrition Education on Osteopathic Medical Students’ Personal Nutrition Choices and Incorporation Into Future Medical Practice
Parker, A. T., Bateman, R., Fastring, D.
Cureus, 2024/08
Free full text
536

A Natural Approach to Bell's Palsy: An Osteopathic Treatment Option
Schneider, N., Shih, S., Rundquist, L., Llanio, L., Kurian, A., Ring, A., Barry, P.
Cureus, 2024/08
Free full text
537

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text
538

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text
539

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08
540

Musculoskeletal Healthcare Professionals' perspectives on objective postural assessment (Expectation and Experience): A UK (Multiprofessional) nationwide survey, 21 August 2024, PREPRINT (Version 1) available at [Journal: Research Square
Martin, D.C., McGuigan, P., Matei, R., Kandasamy, G.
, 2024/08
541

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text
542

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text
543

Students Matriculating into Integrated Plastic Surgery: Are all Medical Schools Equal?
Yau, A., Lentskevich, M. A., Reddy, N. K., Gutowski, K. S., Yau, I., Gosain, A. K.
The Journal of Craniofacial Surgery, 2024/08
544

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text
545

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/07
Free full text
546

Examining differences in trends in the orthopedic surgery match for osteopathic and allopathic medical graduates after the transition to single accreditation
Wood, R. S., Krumrey, J.
Journal of Osteopathic Medicine, 2024/07
Free full text
547

Effects of a novel osteopathic visceral technique for the pancreas on pain and range of motion in a patient with neck pain: Case report
Ferreira Faria, M. Â.
Journal of Bodywork and Movement Therapies, 2024/07
548

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text
549

Examining the Role of Physician Characteristics in Web-Based Verified Primary Care Physician Reviews: Observational Study
Sehgal, N. K. R., Rader, B., Brownstein, J. S.
Journal of Medical Internet Research, 2024/07
Free full text
550

Effectiveness of craniosacral therapy, Bowen therapy, static touch and standard exercise program on sleep quality in fibromyalgia syndrome: A randomized controlled trial
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P., Lakshmi, R. V.
Journal of Integrative Medicine, 2024/07
551

Effect of Visceral Manipulation on Children with Refractory Chronic Functional Constipation: A Randomized Controlled Trial
Zakaryaei, S. A., Ravanbakhsh, M., Javaherizadeh, H., Hakimzadeh, M., Shaterzadeh-Yazdi, M. J.
Arquivos de Gastroenterologia, 2024/07
552

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text
553

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07
554

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text
555

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text
556

Interoceptive bodily awareness in patients seeking pain relief with osteopathic manipulative treatment: an observational cohort pilot study
Emmet, D. K., Davis, G., Pierce-Talsma, S., Shubrook, J. H., Mehling, W.
Journal of Osteopathic Medicine, 2024/07
Free full text
557

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07
558

Kraft- und Spannungsübertragung in der unteren Extremität
(Transmission of force and tension in the lower extremity)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
559

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
560

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text
561

Osteopathie und evidenzbasierte Medizin, Teil 3: Bedeutung der EBM für die Osteopathie
(Osteopathy and evidence-based medicine, part 3: Relevance of EBM for osteopathy)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
562

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07
563

Lehre bereichert und verbindet – das Praxissemester
(Teaching enriches and connects – the practical semester)
Sander, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
564

A survey of current specialty palliative care education in the United States
Dahlin, C., Wright, P. M.
Annals of Palliative Medicine, 2024/07
Free full text
565

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
566

Osteopathie bei Gliedergürtelmuskeldystrophie Miyoshi 3
(Osteopathy for Limb-girdle muscular dystrophy Miyoshi 3)
Ritter, C. I.
Unpublished MSc thesis, 2024/07
Free full text
567

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06
568

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/06
Free full text
569

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
570

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
571

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06
572

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06
573

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Canadian osteopaths
Pelletier, R., Morin, C., Noy, M., Thomson, O. P., Sundberg, T., Leach, M. J.
International Journal of Osteopathic Medicine, 2024/06
574

New Zealand osteopaths’ use of patient-reported outcome measures with patients who have chronic low back pain: A cross-sectional survey
Vallyon, E., Aminian, S., Heath, S.
International Journal of Osteopathic Medicine, 2024/06
575

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06
576

New Zealand osteopaths’ use of patient-reported outcome measures with patients who have chronic low back pain: A cross-sectional survey
Vallyon, E., Aminian, S., Heath, S.
International Journal of Osteopathic Medicine, 2024/06
577

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06
578

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06
579

Osteopathie und inneres Wohlbefinden bei Menschen mit chronischer Erkrankung
(Osteopathy and inner well-being by people with chronic illness)
Fachinger, B. C.
Unpublished MSc thesis, 2024/06
580

Risiken und Komplikationen der zervikalen Manipulation
(Risks and adverse events of cervical manipulation)
Feil-Santos, M.
Unpublished MSc thesis, 2024/06
581

Osteopathie in Deutschland
(Osteopathy in Germany)
, 2024/06
Free full text
582

Der Einfluss von Osteopathie auf Schluckstörung und Erbrechen bei CMS
(The influence of osteopathy on dysphagia and vomiting in CMS)
Hinterreither, R.
Unpublished MSc thesis, 2024/06
583

Osteopathie bei Trinkschwierigkeiten Neugeborener
(Osteopathy for feeding dysfunctions in newborns)
Hofko, P.
Unpublished MSc thesis, 2024/06
584

Osteopathie bei Frühgeborenen-Effekte auf klinische Parameter. Ein systematischer Review
(Osteopathy in premature babies-effects on clinical parameters. A systematic review)
Kaineder, G.
Unpublished MSc thesis, 2024/06
585

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung - Eine qualitative Studie vor der Theorie des Enaktivismus
(Considering Social Factors in the Patient-Osteopath Relationship - A Qualitative Study from the Perspective of Enactivim)
Mayrl, E.
Unpublished MSc thesis, 2024/06
586

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text
587

Der Einfluss von Osteopathie auf Spastik bei einer Multiple Sklerose (MS) Patientin
(The influence of osteopathy on spasticity in a multiple sclerosis (MS) patient)
Pleister, M.I.
Unpublished MSc thesis, 2024/06
588

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06
589

Der Effekt von biodynamischer/energetischer Osteopathie auf Babys 0-6 Monate mit nicht synostotischer Plagiocephalie im Vergleich zur standardisierten Lagerungstherapie (counterpositioning)
(The effectiveness of Biodynamics (bioenergetic Osteopathy) of children 0-6 months with non-synostotic plagiocephaly in relation to counterpositioning therapy)
Tauwel, S.
Unpublished MSc thesis, 2024/06
590

Effects of Osteopathic Manipulative Treatment (OMT) on the Thoracic Duct via Ultrasound Imaging
Atkinson, E., Kawachi, S., Kozar, A. J.
The AAO Journal, 2024/06
591

From finger to breast: OMT helps latch
Barr, J., O'Donnell, A.
The AAO Journal, 2024/06
592

Osteopathic Manipulative Treatment, a Novel Adjunct in Sickle Cell Disease Care: Interim Safety and Feasibility Analysis
Brown, A., Eyassu, E., Hoffmann, L., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
The AAO Journal, 2024/06
593

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06
594

Efficacy of Osteopathic Manipulative Treatment in Post-Stroke Recovery Patients
Dalton, D., Walker, A., Vu, P., Medina, C.
The AAO Journal, 2024/06
595

OMT Improves Diaphragm Range of Motion on Ultrasound Imaging
DiSabato, X., Atkinson, E., Kozar, A. J., Robinson, L., Dixon, E.
The AAO Journal, 2024/06
596

OMT in Headache Management: Systematic Review and Meta-Analysis Protocol
Gibson, E., Will, M., Garcia, C. J., Johnson, R., Kirsch, J. R., Spencer, D. V., Wang, M. Y.F., Rehman, Y., Snider, K. T.
The AAO Journal, 2024/06
597

Osteopathic correction in the complex treatment of women of reproductive age with pelvic organ prolapse
(Остеопатическая коррекция в комплексном лечении женщин репродуктивного возраста с пролапсом тазовых органов)
Bakanova, A. R., Lebedev, D. S., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/06
598

The role of diaphragmatic motion in peritoneal lymphatic absorption examined in case of splenic rupture
King, C., Ettlinger, H.
The AAO Journal, 2024/06
599

The Role of Osteopathic Manipulative Treatment in a Case of Pediatric Craniosynostosis
Kurup, D., Ettlinger, H.
The AAO Journal, 2024/06
600

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06
601

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06
602

More Than a Pain in the Butt: Response to OMT as a diagnostic aid to identify arterial gluteal claudication
Mather, M., Schaefer, M.
The AAO Journal, 2024/06
603

Evaluating the effects of Osteopathic Manipulative Treatments in Pregnancy: Comparing the difference between outpatient versus inpatient treatments on incidence rates of C sections
Politi Gonzalez, C., Torres, J.
The AAO Journal, 2024/06
604

The case for Frequency Specific Microcurent in combination therapy of an acute forearm injury
Shah, A., Johnson, A.
The AAO Journal, 2024/06
605

Dynamic styles of osteopaths based on assessment of the bioelectrical activity of the brain using the method of mathematical analysis of a first-order multivariate structural function
(Динамические стили остеопатов на основе оценки биоэлектрической активности мозга с применением метода математического анализа мультивариативной структурной функции первого порядка)
Piskunova, G. E., Trifonov, M. I., Panasevich, E. A., Belyaev, A. F.
Russian Osteopathic Journal, 2024/06
606

Keeping the MonSter Under Control: The Role of Osteopathic Manipulative Therapy (OMT) in Characterization and Management of Chronic Pain in Multiple Sclerosis
Song, Y. J., Faruque, R., Hall, T., Waddington, M.
The AAO Journal, 2024/06
607

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06
608

Hat die osteopathische Behandlung einen Einfluss auf persistierende Symptome unter Hormonersatztherapie bei Frauen mit einer Hashimoto-Thyreoiditis? Prä-Post-Studie.
(Does individual osteopathic treatment influence persistent symptoms under hormone replacement therapy in women with Hashimoto´s thyreoiditis? A pre-post study )
Kriehmig, S., Vetter, A., Rüdrich, K.
Unpublished D.O. thesis, 2024/06
609

An Osteopathic Approach to Prolonged Surgical Scar and Epidural Site Pain after Cesarean Section: A Case Study
Whitaker, Z., Gailius, G.
The AAO Journal, 2024/06
610

Die osteopathische Behandlung von Patienten mit idiopathischem Parkinson-Syndrom. Prä-Post-Studie.
(Does individual osteopathic treatment influence Parkinson´s disease-specific health related quality of life in patients suffering from idiopathic Parkinson´s disease?
Schellhase, M., Schröter, C.
Unpublished D.O. thesis, 2024/06
611

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06
612

Workin’ 9 to 5, but Now Can Thrive: Chronic Headache Diagnosed and Treated with OMT
Bernett, A. M., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
613

Piriformis or Not Piriformis? The Impact of OMT on Buttock and Hip Pain: A Case Report
Blankenbaker, J., Ural, E.
The AAO Journal, 2024/06
614

Osteopathic Management of Bertolotti Syndrome
Bowen, A., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
615

Resolution of Notalgia Paresthetica Symptoms following Osteopathic Manipulative Treatment (OMT): A Case Report
Bressler, K., Macmillan, G., Mancini, J., Yao, S. C., Papadopoulos, D., Abu-Sbaih, R.
The AAO Journal, 2024/06
616

Invasive Beatmung und prolongiertes Weaning: Auswirkungen osteopathischer Techniksequenzen
(Invasive ventilation and prolonged weaning. Effects of osteopathic sequences of techniques)
Boehme, A., Thönnessen, P., Ibel, R.
Osteopathische Medizin, 2024/06
617

Oh Snap! Osteopathic Treatment of Tendon Rupture with Link to Long Term Statin Use
Carpinelli, S., Richie, C.
The AAO Journal, 2024/06
618

Response to Osteopathic Manipulative Treatment in a Newborn with Breastfeeding Difficulties: A Case Report
Coxon, J., Gannon, T. M.
The AAO Journal, 2024/06
619

Comparison of the effects of abdominal massage and osteopathic manipulative treatment home program on constipation in children with cerebral palsy
Chatip, A. T., Acar, G., Akçay, A. A.
JGH Open, 2024/06
Free full text
620

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06
621

Manual Therapy Interventions in Patients With Chronic Obstructive Pulmonary Disease: A Comprehensive Narrative Review
Chilhate, P. K., Lalwani, L.
Cureus, 2024/06
Free full text
622

“I walk funny and I don’t know why,” Osteopathic manipulative treatment for an adult female with congenital bilateral Femoral Neck Anteversion (FNA)
Fredrickson, T., Broussard, D., Waters, H.
The AAO Journal, 2024/06
623

Osteopathie, was bist du?: Homo- und Heterogenität zwischen osteopathischen und manualmedizinischen Techniken
(Osteopathy, what are you?: Homogeneity and heterogeneity between osteopathic and manual medicine techniques)
Engel, M.
Osteopathische Medizin, 2024/06
624

Stagnating the Symptomatic Progression of Primary Lateral Sclerosis
Geyer-Roberts, E., Desai, B., Perez, J., Grote, J., Helderlein, P., Posey, A.
The AAO Journal, 2024/06
625

The Use of Exercise Prescription in Australian Osteopathy Practice: Secondary Analysis of a Nationally Representative Sample of the Profession
Fleischmann, M., Vaughan, B., Fitzgerald, K.
The Scientific World Journal, 2024/06
Free full text
626

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06
627

Bibliometrische Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2023: Der INIOST-Studienreport 2023
(Bibliometric overview of osteopathic studies published worldwide in 2023: The INIOST Study Report 2023)
Franke, H.
Osteopathische Medizin, 2024/06
628

Development of an Osteopathic Manipulative Treatment Clinician-Parent Home Care Education Intervention for Children with Otitis Media
Krzykwa, E., Pietrantoni, D., Waters, H.
The AAO Journal, 2024/06
629

Transforming Fibromyalgia Care: An Osteopathic Route to Improving Quality of Life
Kurian, A., Schneider, N., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
630

Wie es dazu kam, dass Osteopathie unterrichtet wurde
(How osteopathy came to be taught)
Haxton, J.
Osteopathische Medizin, 2024/06
631

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06
632

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06
633

A case report of improvement of isolated abducens nerve palsy following osteopathic manipulative treatment
Maddie, N., Keys, J.
The AAO Journal, 2024/06
634

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06
635

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06
636

Osteopathische Behandlung neuropathischer Nacken- und Beckenbodenschmerzen
(Osteopathic treatment of neuropathic neck and pelvic floor pain)
Peuker, E.
Osteopathische Medizin, 2024/06
637

Osteopathic Manipulative Treatment in Occipital Neuralgia
Ring, A., Llanio, L., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
638

An Osteopathic Approach to Cervicogenic Vertigo
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2024/06
639

Severe Eczema and Hair Growth Improvements with Osteopathic Manipulative Treatment (OMT) in Pediatric Patient: A Case Study
Sanchez, E., Papadopoulos, D., Yao, S. C., Abu-Sbaih, R.
The AAO Journal, 2024/06
640

An Osteopathic Approach to Temporomandibular Dysfunction Secondary to A Motor Vehicle Accident
Schneider, N., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2024/06
641

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06
642

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text
643

Effect of Osteopathic Manipulative Treatment (OMT) for Symptomatic Headache Relief in Long-COVID Patient: A Case Report
Unser, K., Thomas, A., Cornwell, S., Yao, S. C., Keys, J.
The AAO Journal, 2024/06
644

Osteopathic Manipulative Medicine and Disorders: An Overview of Peer-Reviewed Publications 2018-2022
White, C., Xie, Y., Bigham, J., Stanczak, A., Ninan, D., Hu, C. A.
Cureus, 2024/06
Free full text
645

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06
646

Reducing Blood Pressure: Use of Osteopathic Manipulative Treatment (OMT) as Adjunct Therapy in Treating Uncontrolled Hypertension
Voas, A., Wirth, K., Delaney, C., Li, V., Figueroa, J. S.
The AAO Journal, 2024/06
647

Case Study: The Effect of Osteopathic Manipulation on Diabetic Gastroparesis
Yazdi, S. A., Tucker, D., Hwang, G., Majeed, A., Hsubrook, J. H., Penq, N.
The AAO Journal, 2024/06
648

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung Eine qualitative Interviewstudie vor der Theorie des Enaktivismus
Mayrl, E.
Unpublished MSc thesis, 2024/06
649

Increased Alertness in Comatose Patient After Osteopathic Manipulative Treatment: A Case Report
Garcia, A. E., Kay, K., Perera, M. X., Martinez, E. S., Onyi, S., Nourani, B., Loveless, B.
The AAO Journal, 2024/06
650

A Comparative American Board of Surgery In-Training Examination (ABSITE) Performance Analysis Between International vs. Domestic Graduates and Doctor of Medicine (MD) vs. Doctor of Osteopathic Medicine (DO) Medical Degrees
Rahimpour, A., Morrison, M., Denning, D. A., Bown, P., Ray, P., Barry, R.
Cureus, 2024/06
Free full text
651

An Alternative Approach to Median Arcuate Ligament Syndrome
Geyer-Roberts, E., Wallace-Ross, J.
The AAO Journal, 2024/06
652

The osteopathic concept after a century
Mackenzie, A. S.
The AAO Journal, 2024/06
Free full text
653

Successful Treatment using OMT for Chronic GERD in a Pediatric Patient
Shams, S., Chohan, M. M., King, A.
The AAO Journal, 2024/06
654

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06
655

Post-surgical Median Arcuate Ligament Syndrome (MALS) Symptom Exacerbation Treated With Osteopathic Manipulative Treatment (OMT): A Case Report
Volokitin, M., Bergman, A.
Cureus, 2024/06
Free full text
656

Does regular attendance in supplemental virtual near-peer tutoring in anatomy laboratory content improve anatomy performance for medical students?
Doty, J. E., Thompson, N. E.
Anatomical Sciences Education, 2024/05
657

Der unmittelbare Effekt der Allgemeinen Osteopathischen Behandlung (AOB) auf die posturale Kontrolle bei Patienten/Patientinnen nach Schlaganfall. Eine randomisierte kontrollierte Studie
(The immediate effect of general osteopathic treatment (AOB) on postural control in patients after stroke. A randomized controlled trial)
Brunner, M.
Unpublished MSc thesis, 2024/05
658

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text
659

Der Begriff Selbstheilung – und seine Bedeutung aus Perspektive österreichischer Osteopath:innen
(The concept of self-healing - and its meaning from the perspective of Austrian osteopaths)
Kaiser, K.
Unpublished MSc thesis, 2024/05
660

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
661

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text
662

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text
663

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text
664

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text
665

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05
666

Efficacy of Osteopathic Manipulative Treatment for Pain Reduction in Patients With Patellofemoral Pain Syndrome: A Meta-Analysis of Randomized Controlled Trials
Delgadillo, B. E., Bui, A., Debski, A. M., Miller, B., Wu, S. S.
Cureus, 2024/05
Free full text
667

Celebrating Success: Osteopathic Physicians’ Journey From Match Day to Healthcare Leadership
Gregory, P.
Osteopathic Family Physician, 2024/05
668

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text
669

Effects of Osteopathic Manipulative Treatment Alone or in Combination With Respiratory Training on Chest Wall Expansion, Functional Mobility, and Dyspnea Level in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
American Journal of Respiratory and Critical Care Medicine, 2024/05
670

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text
671

Implementing PathElective as an organized means of supplementing pathology education in an osteopathic medical school-the New York Institute of Technology College of Osteopathic Medicine experience
Plummer, M. M., Mirza, K. M., Lilley, C. M., Eng, N.
Academic Pathology, 2024/05
Free full text
672

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05
673

Implementing paper-based patient-reported outcome collection within outpatient integrative health and medicine
Srinivasan, R., Rodgers-Melnick, S. N., Rivard, R. L., Kaiser, C., Vincent, D., Adan, F., Dusek, J. A.
PLoS One, 2024/05
Free full text
674

A modern way to teach and practice manual therapy
Kerry, R., Young, K. J., Evans, D. W., Lee, E., Georgopoulos, V., Meakins, A., McCarthy, C., Cook, C., Ridehalgh, C., Vogel, S., Banton, A., Bergström, C., Mazzieri, A. M., Mourad, F., Hutting, N.
Chiropractic & Manual Therapies, 2024/05
Free full text
675

Multi-modal Assessment of Myofascial Trigger Point Response to Osteopathic Manipulation in the Anterior Forearm
Pedapati, C.
Unpublished PhD thesis, 2024/05
676

Manual Therapy of Dysphagia in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
De Marchi, I., Buffone, F., Mauro, A., Bruini, I., Vismara, L.
Medicina, 2024/05
Free full text
677

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text
678

Promoting the Integration of Direct-to-Consumer Genetic Testing Results Into Clinical Practice
Glenn, K.
Unpublished PhD thesis, 2024/05
Free full text
679

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04
680

Effects of osteopathic manipulative treatment on children with plagiocephaly in the context of current pediatric practice: a retrospective chart review study
King, H. H., Mai, J., Morelli Haskell, M. A., Wolf, K., Sweeney, M.
Journal of Osteopathic Medicine, 2024/04
Free full text
681

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2024/04
Free full text
682

Effekte der Osteopathie auf posturale Säuglingsasymmetrien und den Stillprozess
(Effects of osteopathy on infant postural symmetry disorders and the breastfeeding process)
Elsässer, S.
Unpublished MSc thesis, 2024/04
683

Effect of manual osteopathic techniques on the autonomic nervous system, respiratory system function and head-cervical-shoulder complex—a systematic review
Stępnik, J., Czaprowski, D., Kędra, A.
Frontiers in Medicine, 2024/04
Free full text
684

Der unmittelbare Effekt einer osteopathischen Behandlung des Caecums - bei PatientInnen nach offener Appendektomie - auf die lumbopelvine Mobilität: eine randomisierte kontrollierte Studie
(The immediate effect of osteopathic treatment of the caecum - in patients after open appendectomy - on lumbopelvic mobility: a randomized controlled trial)
Prodinger, R.
Unpublished MSc thesis, 2024/04
685

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text
686

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text
687

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text
688

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04
689

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text
690

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text
691

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text
692

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text
693

Das Verständnis von deutschsprechenden Osteopath:innen der Schweiz bezüglich des Nervus vagus und dessen Integration in den Praxisalltag : eine qualitative Studie
(The understanding of German-speaking osteopaths in Switzerland regarding the vagus nerve and its integration into everyday practice : a qualitative study)
Eggenberg, E., Gottschalk, Y., Koller, M.
Unpublished MSc thesis, 2024/04
Free full text
694

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text
695

L'intégration de la thématique du surpoids et de l'obésité en consultation ostéopathique : une étude qualitative phénoménologique
(The integration of the theme of overweight and obesity in osteopathic consultation: a phenomenological qualitative study)
Golay, S., Jordan, S.
Unpublished MSc thesis, 2024/04
Free full text
696

Quelle est la place de la respiration du·de la patient·e lors d’une consultation ostéopathique chez les ostéopathes pratiquant en Suisse : une étude qualitative phénoménologique
(What is the place of the patient's breathing during an osteopathic consultation among osteopaths practicing in Switzerland: a phenomenological qualitative study?)
Gremaud, L., Guggisberg, F., Marti, J., Morisetti, L.
Unpublished MSc thesis, 2024/04
Free full text
697

Quel raisonnement clinique adoptent les ostéopathes travaillant en Suisse romande pour le traitement des patient·e·s consultant pour un motif de céphalées ? : une étude qualitative
(What clinical reasoning do osteopaths working in French-speaking Switzerland adopt for the treatment of patients consulting for a reason of headache? A qualitative study)
Rey, S., Caviglioli, M.
Unpublished MSc thesis, 2024/04
Free full text
698

Que signifie l’infertilité pour les ostéopathes suisses et quelle est l’importance de la fertilité dans leur pratique ostéopathique?
(What does infertility mean to Swiss osteopaths, and how important is fertility to their osteopathic practice?)
Schär, S., Sarlandie, M.
Unpublished MSc thesis, 2024/04
Free full text
699

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
700

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text
701

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03
702

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
703

Osteopathic management of non-specific neck pain: Preliminary findings from a cross sectional study of Australian osteopaths
Fleischmann, M., McLaughlin, P., Vaughan, B., Hayes, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
704

Perceptions of Australian osteopaths on the use of telehealth for patient care: Barriers and enablers for implementation
Grace, S., Engel, R., Mastronardo, C., Muddle, L., Fleischmann, M., Vaughan, B., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
705

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03
706

Fluid professional boundaries: ethnographic observations of co-located chiropractors, osteopaths and physiotherapists
Toloui-Wallace, J., Forbes, R., Thomson, O. P., Costa, N.
BMC Health Services Research, 2024/03
Free full text
707

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03
708

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
709

Osteopathic correction in complex rehabilitation of children who have undergone cochlear implantation
(Остеопатическая коррекция в комплексной реабилитации детей, перенесших кохлеарную имплантацию)
Belash, V. O., Revina, M. B.
Russian Osteopathic Journal, 2024/03
710

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03
711

Osteopathic correction in the complex therapy of children with astigmatism
(Остеопатическая коррекция в комплексной терапии детей с астигматизмом)
Kiryanova, E. V., Gurichev, A. A.
Russian Osteopathic Journal, 2024/03
712

Rehabilitation after severe gaff disease
(Реабилитация после тяжелого течения гаффской болезни)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03
713

Osteopathic Approach to a Patient with Recurring Low Back Pain following OMT results in Diagnosis of Underlying Gynecological Etiology: A Case Report
Berkowitz, M. R.
The AAO Journal, 2024/03
Free full text
714

The Use of Osteopathic Manipulative Treatment for a Case of Cervical Radiculopathy
Heineman, K.
The AAO Journal, 2024/03
Free full text
715

Влияние комплексного лечения с включением остеопатической коррекции на интенсивность боли и качество жизни пациентов с хроническим тонзиллитом
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushkin, S. A.
Russian Osteopathic Journal, 2024/03
716

An osteopathic approach for a patient with sequela after treatment for a cheek squamous cell carcinoma
Wehner, B. L., Calla, R.
The AAO Journal, 2024/03
Free full text
717

The Effects of Patient-specific Sequenced Osteopathic Manipulative Treatment by AGR on Quality of Life
Yang, Y., Stiles, E., Kingery, J.
The AAO Journal, 2024/03
718

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03
719

Fallbericht einer psychosomatischen Osteopathie
(Case report of psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2024/03
Free full text
720

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
721

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03
722

Osteopathie und evidenzbasierte Medizin, Teil 2: Kritik an der EBM
(Osteopathy and evidence-based medicine, part 2: Criticism of EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
723

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
724

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
725

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
726

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03
727

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of Osteopathic Medicine, 2024/03
Free full text
728

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2024/03
Free full text
729

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03
730

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03
731

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text
732

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text
733

Neurofisiologia, interazioni neuro-immunitarie e meccanobiologia nell’osteopatia craniale. Una prospettiva basata sull’evidenza per un razionale scientifico
Casini, A., Barsotti, N., Chiera, M., Lunghi, C., Fornari, M., Lanaro, D.
PNEI REVIEW, 2024/03
734

Academic Degree Bias Among Speaking and Leadership Roles at the American Academy of Orthopaedic Surgeons Annual Meetings, 2016-2021
Bartlett, L., Daley, A., Kazimierczak, A., Klein, B., Humbyrd, C., Bitterman, A., Cohn, R.
Cureus, 2024/03
Free full text
735

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03
736

Utility of Osteopathic Manipulation Treatment in MTBI Patients With PPCS and Cervicogenic & Vestibuloocular Profiles
Chen, A., Gross, A., Marshall, J., Anilkumar, A., Patel, N., Maes, L., Mulumba, D., Dusenberry, B.
Clinical Journal of Sport Medicine, 2024/03
737

Investigation of Immediate Effects of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S., Matthias, A., Roush, A., Wilson, H., Nicholas, J., Edwards, C., Mangum, K., Pickett, B.
Clinical Journal of Sport Medicine, 2024/03
738

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03
739

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text
740

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text
741

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03
742

Effect of physiotherapy on infertility treatment in polycystic ovary syndrome patients
Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jędrzejczyk, S., Jerzak, M., Jerzak, M.
Przegląd Menopauzalny, 2024/03
743

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03
744

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
745

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
Free full text
746

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text
747

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text
748

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text
749

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02
750

Osteopathic Manipulative Treatment for Chronic Neck Stiffness After a Motor Vehicle Collision: A Case Report
Jost, J. M., Stoll, V. K., Waters, H. B.
Cureus, 2024/02
Free full text
751

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text
752

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text
753

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02
754

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02
755

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02
756

Osteopathic Approach in the Stimulation of the Endocannabinoid System: A Case Report
Buonomini, C., Bonetti, O., Novelli, E.
Cureus, 2024/02
757

Transrectal osteopathic manipulation treatment for chronic coccydynia: feasibility, acceptability and patient-oriented outcomes in a quality improvement project
Nourani, B., Norton, D., Kuchera, W., Rabago, D.
Journal of Osteopathic Medicine, 2024/02
Free full text
758

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
759

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
760

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02
761

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text
762

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
763

Clinical Effectiveness of Craniosacral Therapy in Patients with Headache Disorders: A Systematic Review and Meta-analysis
Carrasco-Uribarren, A., Mamud-Meroni, L., Tarcaya, G. E., Jiménez-Del-Barrio, S., Cabanillas-Barea, S., Ceballos-Laita, L.
Pain Management Nursing, 2024/02
764

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text
765

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
766

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text
767

Neurosurgery Clerkships in United States Medical Schools: A Survey of Doctor of Medicine–Granting and Doctor of Osteopathic Medicine–Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2024/01
768

Zwischen Evidenz und individueller klinischer Expertise – ein Vergleich der Konzeption der Evidenzbasierten Medizin und den Anliegen der Osteopathie
(Between evidence and individual clinical expertise – a comparison of the concept of evidence-based medicine and the concerns of osteopathy)
Stierl, J. A.
unpublished MSc thesis, 2024/01
769

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text
770

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
771

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
772

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
773

Osteopathie und evidenzbasierte Medizin, Teil 1: die EBM
(Osteopathy and evidence-based medicine, part 1: EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
774

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
775

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text
776

Characteristics, Opportunities, and Challenges of Osteopathy Based on the Perceptions of Osteopaths in Austria: Qualitative Interview Study
Manschel, J., Porthun, J., Winkler, U., Beuckels, J. M., Martin, D.
JMIR Human Factors, 2024/01
Free full text
777

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
778

Peut-on protocoliser l’ostéopathie? Doit-on toujours manipuler L5 en cas de sciatalgie type L5?
(Could Osteopathy Be Protocolized? Should We always Manipulate L5 in Case of L5 Sciatica?)
Bœuf, M., Brun, L.
Douleur et Analgesie, 2024/01
779

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12
780

Impact of the COVID-19 Pandemic on First Year Medical Students at the West Virginia School of Osteopathic Medicine
Towne, D., Easler, J., Eleazar, C.
Journal of Osteopathic Medicine, 2023/12
781

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12
782

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12
783

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
784

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
785

Long-/Post-Covid-Syndrom: Studienergebnisse zur therapeutischen Erfahrung von Osteopath*innen in Deutschland
(Long-/Post-Covid syndrome: Study results on the therapeutic experience of osteopaths in Germany)
Plathner, M.
Osteopathische Medizin, 2023/12
786

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text
787

Letter to the Editor: Underlining there is nothing wrong with osteopathy
Espírito Santo, J., Moita, J., Campos, B., Nunes, A.
International Journal of Osteopathic Medicine, 2023/12
788

Views from Australian osteopaths and industry stakeholders about the profession: A qualitative study
Mastronardo, C., Muddle, L., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2023/12
789

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
790

Letter to the Editor regarding: Thomson OP, and MacMillan A. What’s wrong with osteopathy?
Noy, M.
International Journal of Osteopathic Medicine, 2023/12
791

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
792

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
793

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12
794

Letter o the Editor: Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
795

Letter to the Editor: There is nothing wrong with osteopathy
van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/12
796

Application of craniosacral therapy in practice
Wójcik, M., Placek, K., Bordoni, B.
Polish Journal of Physiotherapy, 2023/12
797

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12
798

Evaluation of effectiveness of osteopathic visceral manipulation in patients with chronic mechanical low back pain: A multi-center, single-blind, randomized-controlled study
Altınbilek, T., Murat, S., Yıldırım, E., Filiz, B., Ünlü, S., Terzi, R.
Turkish Journal of Physical Medicine and Rehabilitation, 2023/12
799

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
800

The use of osteopathic correction in the treatment of patients with sciatic neuropathy
(Применение остеопатической коррекции в терапии пациентов с седалищной нейропатией)
Belash, V. O., Frolov, V. A.
Russian Osteopathic Journal, 2023/12
Free full text
801

The effect of general osteopathic treatment on muscle tone according to electromyography data
(Влияние общего остеопатического лечения на тонус мышц по данным электромиографии)
Cherednikova, N. V., Zhang, V. F., Potekhina, Y. P., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/12
Free full text
802

Satisfaction and readiness for professional activity of students of the Institute of Osteopathy (Saint-Petersburg): a study using the DREEM questionnaire
(Удовлетворенность и готовность к профессиональной деятельности слушателей Института остеопатии (Санкт-Петербург): изучение с использованием опросника DREEM)
Filenko, A. B., Tregubova, E. S.
Russian Osteopathic Journal, 2023/12
Free full text
803

The possibility of reversibility of liver fibrosis under the influence of complex treatment
(Возможность обратимости фиброза печени под влиянием комплексного лечения)
Kozhokina, S. G.
Russian Osteopathic Journal, 2023/12
Free full text
804

Osteopathic Manipulative Treatment to Treat Patients with Long-Haul COVID Loss of Smell and Taste: A Report of Four Cases
Berkowitz, M. R.
The AAO Journal, 2023/12
Free full text
805

Osteopathic Manipulative Treatment for the Management of Irritable Bowel Syndrome: A Case Report
Heineman, K.
The AAO Journal, 2023/12
Free full text
806

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text
807

‘More harm than good’ – A qualitative study exploring the attitudes and beliefs of a group of Italian osteopaths about spinal imaging in the management of patients with chronic low back pain
Ogliari, L., Formica, A., Bettelli, L.
International Journal of Osteopathic Medicine, 2023/12
808

Letter to the Editor regarding: Thomson OP, and MacMillan A. What’s wrong with osteopathy?
Noy, M.
International Journal of Osteopathic Medicine, 2023/12
809

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text
810

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text
811

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
812

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text
813

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12
814

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text
815

Osteopathy Referrals to and from General Practitioners: Secondary Analysis of Practitioner Characteristics from an Australian Practice-Based Research Network
Vaughan, B., Fleischmann, M., Grace, S., Engel, R., Fitzgerald, K., Steel, A., Peng, W., Adams, J.
Healthcare, 2023/12
Free full text
816

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12
817

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text
818

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text
819

The Influence of Osteopathic Manipulative Treatment (OMT) on Cognitive Performance and Recovery Following a Sport-Related Concussion
Bennett, R., Peart, Z., Brett, J., Posey, A.
Journal of Osteopathic Medicine, 2023/12
820

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12
821

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12
822

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12
823

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12
824

Retrospective Study of Osteopathic Manipulative Treatment Use for Pain in Patients with Ehlers Danlos Syndromes and Hypermobility Spectrum Disorder (EDS/HSD)
Chung, M. J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
825

National Prevalence and Quality of Medical Spanish Education in US Osteopathic Medical Schools: An Approach to Improve Health Equity
Dey, K. A., Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2023/12
826

Social congruence between Osteopathic medical students and figures of support at NYIT College of Osteopathic Medicine
Doty, J. E., Thompson, N. E.
Journal of Osteopathic Medicine, 2023/12
827

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12
828

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12
829

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12
830

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12
831

Effectiveness of Osteopathic Tenet Integration into Basic Science Learning Objectives Using Generative Artificial Intelligence
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2023/12
832

Cranial Osteopathic Manipulation Alters Alzheimer’s Disease Phenotype in Wild Type and Transgenic Rats
Hines, D. Y., Tobey, H., Kwaspisz, L., Ingram, A., Duggan, P., Boehringer, S., Piwowarski, J., Ramanathan, A., Anandakrishnan, R.
Journal of Osteopathic Medicine, 2023/12
833

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
834

Osteopathic Cranial Manipulation and its Possible Application in Managing Hypertension for the Optimization of Care
Jackson, S., Chung, T. C., Arellano, A., Keane, J. F., Goldstein, L. B.
Journal of Osteopathic Medicine, 2023/12
835

Making sense of cranial osteopathy: An interpretative phenomenological analysis
Banton, A., Vogel, S., Lee-Treweek, G.
International Journal of Osteopathic Medicine, 2023/12
Free full text
836

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12
837

Differences in Learning Approach and Resource Utilization Between First- and Second-Year Osteopathic Medical Students
Jose, R. M., Goldstein, L.
Journal of Osteopathic Medicine, 2023/12
838

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/12
839

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12
840

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12
841

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12
842

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
843

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12
844

Factors contributing to or impeding the development of OPP knowledge and skills among COM students – A Cross-Sectional Survey
Roberts, T., Wardle, M., Pryor, J.
Journal of Osteopathic Medicine, 2023/12
845

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
846

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12
847

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12
848

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12
849

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12
850

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/11
Free full text
851

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text
852

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text
853

Neurophysiology, Neuro-Immune Interactions, and Mechanobiology in Osteopathy in the Cranial Field: An Evidence-Informed Perspective for a Scientific Rationale
Barsotti, N., Casini, A., Chiera, M., Lunghi, C., Fornari, M.
Healthcare, 2023/11
Free full text
854

Osteopathic Cranial Manipulative Medicine as a Proposed Addition to the Treatment Regimen for Idiopathic Sudden-Onset Unilateral Sensorineural Hearing Loss: A Case Report
Sina, R. E., Lippert, J., Guardardo, K.
Cureus, 2023/11
Free full text
855

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text
856

Hat eine osteopathische Behandlung der Membrana obturatoria Einfluss auf die Range-of-Motion des Hüftgelenks? Eine randomisierte kontrollierte Studie
(Does osteopathic treatment of the obturator membrane influence the range of motion of the hip joint? A randomized controlled trial)
Grillnberger, A.
Unpublished MSc thesis, 2023/11
857

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text
858

Erwartungen von PatientInnen der deutschsprachigen Schweiz an OsteopathInnen und die osteopathische Behandlung
(Expectations of patients in German-speaking Switzerland regarding osteopaths and osteopathic treatment)
Hanke, K.
Unpublished MSc thesis, 2023/11
859

Die Effektivität der osteopathischen Behandlung bei Fibromyalgie: ein systematisches Review
(The effectiveness of osteopathic treatment in Fibromyalgia: a systematic review)
Huber, K. E.
Unpublished MSc thesis, 2023/11
860

The Effect of Craniosacral Therapy on Blood Levels of Stress Hormones in Male Firefighter Cadets: A Randomized Clinical Trial
Wójcik, M., Bordoni, B., Siatkowski, I., Żekanowska, E.
Behavioral Sciences, 2023/11
861

Umfrage zum Long-/Post-COVID-Syndrom in der osteopathischen Praxis – eine Umfragestudie
(Survey on long/post-COVID syndrome in osteopathic practice - a survey study)
Plathner, M.
Unpublished MSc thesis, 2023/11
862

Anorexie mentale et médiations somatiques : évaluations croisées de l’ostéopathie et de la psychomotricité sur les préoccupations corporelles
(Osteopathy and Anorexia Nervosa: Cross-evaluations of osteopathy and psychomotricity on bodily concerns)
Mattatia, J., Gaha, N., Cottin, L., Mattatia, D., Morelle, Q., Truong, R., Saussé-Corbière, L., Yi, M.K.
Annales Médico-psychologiques, revue psychiatrique, 2023/11
863

Der Effekt einer osteopathischen Behandlung verglichen mit einer Scheinbehandlung, auf das autonome Nervensystem, gemessen mit der Herzratenvariabilität, bei Long/Post COVID-19 Patienten mit Fatigue Syndrom: Eine klinische randomisierte kontrollierte Studie
(The effect of osteopathic treatment compared with sham treatment on the autonomic nervous system, as measured by heart rate variability, in long/post COVID-19 patients with fatigue syndrome: A clinical randomized controlled trial)
Pöhlmann, T.
Unpublished MSc thesis, 2023/11
864

Osteopathic Manipulative Treatment on Predominantly African American Hospitalized Coronavirus Disease 2019 Patients during Michigan’s First Wave.
Soni, E., Kattan, M., Jackson, N. M., Mainor, I., Corser, W.
MI Medical Education and Health Bulletin, 2023/11
Free full text
865

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2023/11
866

Die Selbsteinschätzung von Intuition und analytischer Erkenntnis in Bezug auf Anamnese und Befund bei österreichischen OsteopathInnen
(Self-assessment of intuition and analytical knowledge in relation to anamnesis and diagnosis of Austrian osteopaths)
Brandstötter, M.
Unpublished MSc thesis, 2023/11
867

Osteopathie bei Spannungskopfschmerzen - Eine systematische Übersichtsarbeit
(Osteopathy for tension-type headache - a systematic review)
Gollonitsch, P.
Unpublished MSc thesis, 2023/11
Free full text
868

Ein systematischer Überblick über die Wirkung der Osteopathie auf die Atemfunktion bei gesunden und kranken Erwachsenen
(A Systematic Review on the Effect of Osteopathic Treatment on Respiratory Function in Healthy and Sick Adults)
Haas, E.
Unpublished MSc thesis, 2023/11
869

Der Einfluss des „general osteopathic treatment“ (GOT) auf das Gangbild, die Funktionalität und posturale Kontrolle von Schlaganfallpatient*innen. Eine randomisierte kontrollierte Pilotstudie
(The influence of “general osteopathic treatment“ (GOT) on gait, functionality and postural control in stroke patients. A randomized controlled pilot study)
Mühlbauer, T.
Unpublished MSc thesis, 2023/11
870

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11
871

Wirksamkeit osteopathischer Techniken bei Endometriose
(Efficacy of osteopathic techniques in endometriosis)
Schiche, S.
Unpublished MSc thesis, 2023/11
872

Hat eine auf Körperflüssigkeit und Diaphragmen basierende osteopathische Behandlung in Kombination mit Physiotherapie eine bessere Wirkung auf die gesundheitsbezogene Lebensqualität bei ambulant betreuten MS-PatientInnen als ausschließlich physiotherapeutische Behandlung?
(Does body fluid and diaphragm-based osteopathic treatment combined with physical therapy have a better effect on health-related quality of life in outpatients with MS than physical therapy alone?)
Shikha, K.
Unpublished MSc thesis, 2023/11
873

Welchen Einfluss hat eine osteopathische Behandlung auf Stress?
(What is the impact of osteopathic treatment on stress?)
Soika, V.
Unpublished MSc thesis, 2023/11
874

Die Wirksamkeit osteopathischer Interventionen auf die Parameter FEV1 and FVC gemessen mittels Spirometrie
(Effectiveness of osteopathic interventions on the spirometric values FEV1 and FVC)
Söllradl, C.
Unpublished MSc thesis, 2023/11
875

Die Wirksamkeit der osteopathischen Therapie als Komplementärmedizin bei PatientInnen mit einer kardiovaskulären Erkrankung Systematischer Review
(The effectiveness of osteopathic manipulative treatment as complementary medicine for patients with cardiovascular disease A systematic review)
Tänzer, M. C.
Unpublished MSc thesis, 2023/11
Free full text
876

Pericardial Adhesion and Chronic Non-Specific Neck Pain following Thoracentesis: An Osteopathic Approach
Bordoni, B., Escher, A.
Clinics and Practice, 2023/10
Free full text
877

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text
878

Updates on Diversity Among Cardiology-Related Fellowships
Walk, C. T., Lantz, R.
Cureus, 2023/10
879

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10
880

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/10
Free full text
881

Effect of acupuncture combined with rehabilitation on Postoperative gastrointestinal dysfunction after abdominal operation
Xing, W.
Clinical Nutrition ESPEN, 2023/10
882

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text
883

A biopsychosocial approach as a part of an osteopathic intervention in the management of chronic prostatitis/chronic pelvic pain: A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2023/10
884

The Use of Osteopathic Manipulative Treatment for Treatment of Sore Throat, Headache, and Facial Pain: A Case Report
Berkowitz, M. R.
The AAO Journal, 2023/09
Free full text
885

Case History #4
Coffey, D.
The AAO Journal, 2023/09
Free full text
886

Diagnosis and Treatment of a Dynamic Strain Vector after a Motor Vehicle Accident
Gustowski, S.
The AAO Journal, 2023/09
Free full text
887

Resolution of Stridor, Gastritis and Cephalgia in an Adolescent with Reflex Sympathetic Dystrophy Following Osteopathic Manipulative Treatment—A Case Report
Habenicht, A. L.
The AAO Journal, 2023/09
Free full text
888

Changes in the osteopath′s brain bioelectrical activity while listening to the patient′s cranial rhythmic impulse (pilot study
(Изменения биоэлектрической активности мозга врача-остеопата в процессе прослушивания краниального ритмического импульса пациента (пилотное исследование)
Piskunova, G. E., Belyaev, A. F.
Russian Osteopathic Journal, 2023/09
Free full text
889

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text
890

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09
891

The extent and quality of evidence for osteopathic education: A scoping review
MacMillan, A., Gauthier, P., Alberto, L., Gaunt, A., Ives, R., Williams, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/09
892

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09
893

The profile of French osteopaths: A cross-sectional survey
Wagner, A., Ménard, M., Jacquot, E., Marangelli, G., Merdy, O., Clouzeau, C., Tavernier, P., Verbeeck, J., Vaucher, P., Esteves, J. E., Cerritelli, F., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/09
894

Osteopathic treatment for cam-type Femoroacetabular impingement syndrome: A case report
Kilic, R. T., Yosmaoglu, H. B., Bayrakci Tunay, V.
International Journal of Osteopathic Medicine, 2023/09
895

The effectiveness of disinfection protocols in medical school osteopathic manipulative medicine labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/09
Free full text
896

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/09
Free full text
897

The role of manual therapy for osteopaths in the management of temporomandibular disorders: A qualitative study
McComish, N.
Unpublished MSc thesis, 2023/09
Free full text
898

New Zealand osteopaths’ use of patient-reported outcome measures with patients who have chronic low back pain: A cross-sectional survey
Vallyon, E. N.A.
Unpublished MSc thesis, 2023/09
Free full text
899

Der Einwärtsgang – Physiologie oder Pathologie?
(The inward gait - physiology or pathology?)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
900

Possibilities of non-drug methods of treatment for chronic pelvic pain syndrome in men (systematic review
(Возможности немедикаментозных методов лечения при синдроме хронической тазовой боли у мужчин (систематический обзор)
Krikunov, A. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/09
Free full text
901

Observational study of the effects of an osteopathic treatment for patients with fibromyalgia
(Эффективность остеопатического лечения пациентов, страдающих фибромиалгией (обсервационное исследование)
Laroche, F., Bellan, E., Doléac, M., Meslé, R., Marty, M., Rostaing, S.
Russian Osteopathic Journal, 2023/09
Free full text
902

Change in the clinical status of a patient with dysfunction of the temporomandibular joint after osteopathic correction of somatic dysfunctions
(Изменение клинического статуса пациента с дисфункцией височно-нижнечелюстного сустава после остеопатической коррекции соматических дисфункций)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2023/09
Free full text
903

Study of the possibility of using osteopathic correction for the treatment of patients with non-erosive gastroesophageal reflux disease
(Исследование возможности применения остеопатической коррекции для лечения пациентов с неэрозивной гастроэзофагеальной рефлюксной болезнью)
Pirogov, R. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/09
Free full text
904

(Changes in the osteopath′s brain bioelectrical activity while listening to the patient′s cranial rhythmic impulse (pilot study))
Piskunova, G. E., Belyaev, A. F.
Russian Osteopathic Journal, 2023/09
905

Osteopathic Manipulative Therapy (OMT) as an adjunct to postoperative care for patients with gynecologic malignancies (174)
Ettorre, V., Wagreich, A., Meelheim, B., Torres, J.
Gynecologic Oncology, 2023/09
906

Influence of Osteopathic Manipulative Treatment on the Quality of Life and the Intensity of Lumbopelvic Pain in Pregnant Women in the Third Trimester: A Prospective Observational Study
Correia, M. L. A., Peixoto Filho, F. M., Gomes Júnior, S. C.
Healthcare, 2023/09
Free full text
907

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text
908

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09
909

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09
910

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
911

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
912

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
913

A Novel Approach to Assessing and Conservatively Treating Anterior Cutaneous Nerve Entrapment Syndrome: A Case Study
Newman, D. P., Holkup, S. M., Masi, E. L., Soto, A. T.
Cureus, 2023/09
Free full text
914

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text
915

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09
916

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09
917

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
918

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: randomized controlled trial
Boas Fernandes, W. V., Correa, F. I., Fidelis de Paula Gomes, C. A., Blanco, C. R., Lucareli, P. R. G., Politti, F., Correa, J. C. F.
Gait and Posture, 2023/09
919

Forschung zum Cranial Rhythmic Impulse (CRI) in der osteopathischen Medizin
(Research on the Cranial Rhythmic Impulse (CRI) in Osteopathic Medicine)
Pelz, H., Keller, M., Müller, G., Borik, S., Perlitz, V.
Osteopathische Medizin, 2023/09
920

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
921

Fallbericht: Phänodynamisch-osteopathische Behandlung eines Hygroms
(Case report: Phenodynamic-osteopathic treatment of a hygroma)
Weber, K.H.
Osteopathische Medizin, 2023/09
922

Evaluation of the impact of a communication focused curriculum intervention in an undergraduate osteopathy programme
Muddle, L.
Unpublished PhD thesis, 2023/08
Free full text
923

Medical Uncertainty of Future Physicians: Socialization and Uncertainty Management in Medical Education
Duty, K. M.
Unpublished PhD thesis, 2023/08
924

Understanding the Use of Program Resources During Virtual Recruitment by Psychiatry Residency Applicants
Bernstein, S. A., Hodgins, G. E., Abu-Hamad, S., Gih, D. E., Gold, J. A.
Academic Psychiatry, 2023/08
Free full text
925

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/08
Free full text
926

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/08
Free full text
927

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08
928

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text
929

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text
930

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text
931

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text
932

Effects of the Fourth Ventricle Compression Technique and Rib Raising Osteopathic Technique on Autonomic Nervous System Activity Measured by Heart Rate Variability in 35 Healthy Individuals
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2023/08
Free full text
933

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text
934

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
935

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07
936

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07
937

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text
938

Modifying functional brain networks in focal epilepsy by manual visceral-osteopathic stimulation of the vagus nerve at the abdomen
Lehnertz, H., Broehl, T., Rings, T., von Wrede, R., Lehnertz, K.
Frontiers in Network Physiology, 2023/07
Free full text
939

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07
940

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text
941

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07
942

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
943

Effectiveness of Osteopathic Manipulative Treatment in Treating Symptoms of Irritable Bowel Syndrome: A Literature Review
Lotfi, C., Blair, J., Jumrukovska, A., Grubb, M., Glidden, E., Toldi, J.
Cureus, 2023/07
Free full text
944

Cambios físicos y metabólicos desencadenados tras la manipulación osteopática
(Physical and metabolic changes triggered by osteopathic manipulation)
Melo, M., Alberto, R.
Unpublished MSc thesis, 2023/07
Free full text
945

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text
946

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text
947

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
948

Operative Herangehensweise bei und osteopathische Behandlung nach Hüft-TEP-Implantation
(Operative approach to and osteopathic treatment after hip TEP implantation)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
949

Osteopathy—A philosophical perspective. Reflections on Sutherland’s experience of the tide
Masiello, D. J.
The AAO Journal, 2023/06
Free full text
950

Der biodynamische Behandlungsansatz in der osteopathischen Praxis – eine qualitative Interviewstudie
(The biodynamic treatment approach in osteopathic practice - a qualitative interview study)
Grasmück, J., Müller, F., Kienzler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
951

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
Free full text
952

Die Lebendigkeit des Selbst – das gesunde Immunsystem
(The vitality of the self - the healthy immune system)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
953

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
Free full text
954

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
955

Examination of “The Tide,” CRI, and Physiologic Respiration: A Mathematical Analysis
Berkowitz, M. R.
The AAO Journal, 2023/06
Free full text
956

Osteopathic Management of Pediatric Feeding Disorder, Oral Aversion, and Growth Faltering: A Case Report
Beveridge, E., Magoun, M. A.
The AAO Journal, 2023/06
Free full text
957

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
Free full text
958

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
959

Comparison of Tone and Stiffness Changes to Lumbar Paraspinal Muscle with Varying Osteopathic Treatment Modalities (254)
Companion, N., Guha, A., Naeem, A., Abu-Sbaih, R., Keys, J., Yao, S.
The AAO Journal, 2023/06
Free full text
960

The Effects of Osteopathic Manipulative Treatment (OMT) on an Infant with Failure to Thrive (FTT); A Case Study
Cornwell, S., Yao, S., Abu-Sbaih, R.
The AAO Journal, 2023/06
Free full text
961

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
Free full text
962

Tackling Structure and Function with an Osteopathic Approach: A Patient with a Herniated Lumbar Disc and a Small Hemipelvis
Danto, S. E., Danto, J. B.
The AAO Journal, 2023/06
Free full text
963

Stop Chasing the Pain: An Osteopathic Approach to Treating Migrating Pain Caused by Lumbar Radiculopathy- the Importance of Treating the Cause not the Symptoms
Desai, B., Baxter, C., Widboom, N.
The AAO Journal, 2023/06
Free full text
964

Drug Induced Tibial Nerve Neuropathy in Former Collegiate Baseball Player
Dickey, Z., Turnbull, J., Sharma, N., Aldret, S.
The AAO Journal, 2023/06
Free full text
965

Cranial Osteopathic Manipulative Treatment for Post-COVID Syndrome
Drakeley, C., Shah, R., Waters, H., Mehra, R., Kumaran, N., Johnson, T.
The AAO Journal, 2023/06
Free full text
966

Stalled out: An Osteopathic Approach To A Post-Traumatic Gastroparesis
Fisher, B., Vijayakar, R., Coppinger, J., Motashaw, V.
The AAO Journal, 2023/06
Free full text
967

An Osteopathic Approach to Shoulder Injury Following Post-Hemorrhage Hemiparesis
Geyer-Roberts, E., Helderlein, P., Wallace-Ross, J.
The AAO Journal, 2023/06
Free full text
968

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06
Free full text
969

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
970

Cranial for Chronic pain: The efficacy of osteopathic manipulative treatment (OMT) in the management of chronic post-traumatic headache (CPTHA)
Helderlein, P., Geyer-Roberts, E., Widboom, N.
The AAO Journal, 2023/06
Free full text
971

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
Free full text
972

Treatment of A Pediatric Patient with Right Eye Esotropia using Osteopathic Manipulative Treatment
Inouye, K., Magoun, M. A.
The AAO Journal, 2023/06
Free full text
973

Assessing Differences in Palpation Pressure between Osteopathic Medical Students and Osteopathic Physicians
Jacob, T., Khalid, A., Syed, F., Jose, R., Nikprelaj, K., Frankini, E., Yao, S., Toma, M.
The AAO Journal, 2023/06
Free full text
974

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
Free full text
975

The Effects of Osteopathic Manipulative Treatment (OMT) on Rare Diseases- Gordon Syndrome
Johnson, T. A., Waters, H.
The AAO Journal, 2023/06
Free full text
976

Osteopathic Manipulative Treatment for Enhanced Functional Recovery in Stroke Survivors
Kumaran, N., Drakeley, C., Waters, H., Mehra, R.
The AAO Journal, 2023/06
Free full text
977

Learning abnormal physical examination signs: an introductory course
Sabirov, A., Chludzinski, M., Eminof, E., Eddy, A., Gallagher, J., Jung, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
978

Use of Micronized Lipoaspirate with Platelet-rich Plasma Injection and 3D Tenotomy for Treatment of a Longitudinal Peroneal Brevis Tear
Lambert, M., Fremarek, N., Kozar, A.
The AAO Journal, 2023/06
Free full text
979

The 5 Models of Osteopathic Medicine, An Approach to Transgendered Care: A Case Report
Lentz, A., Koehler, T., Caldwell, G., Fremarek, N.
The AAO Journal, 2023/06
Free full text
980

Case Study on the Effect of Osteopathic Manipulation on Gallbladder Ejection Fraction
Lin, E., Montalvo, E., Garcia Garcia, D., Adams, N., Sparks, C., Gibson, J., Seals, R.
The AAO Journal, 2023/06
Free full text
981

Effect of Muscle Energy Technique (MET) on muscle parameters and lower extremity functionality in a Parkinson’s Disease (PD) patient: A case report
Macmillan, G., Radigan, R., Finkelstein, A., Yao, S.
The AAO Journal, 2023/06
Free full text
982

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
Free full text
983

Effects of OMT on Running Performance and Recovery
Matz, O., Gustafson, H., Hartwell, L., Rudberg-Post, L., Lewis, D.
The AAO Journal, 2023/06
Free full text
984

Osteopathic Manipulative Treatment for Chemotherapy-Induced Abdominal Pain and Anorexia in Glioblastoma Multiforme
McIntire, R., Terry, R., Gebhardt, G.
The AAO Journal, 2023/06
Free full text
985

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
Free full text
986

An Osteopathic Approach to Dysmenorrhea
Paul, H., Bonner, P., Mehra, R.
The AAO Journal, 2023/06
Free full text
987

A Case of Chronic Postoperative Abdominal Wall Pain Successfully Treated with the Fascial Distortion Model
Pelletier, J., Boucher, J.
The AAO Journal, 2023/06
Free full text
988

Osteopathie in Österreich: Wirksamkeit und Sicherheit bei Schmerzen des Bewegungsapparats und Überblick über Ausbildung und Qualitätsanforderungen
(Osteopathy in Austria: Effectiveness and safety in treating pain of the musculoskeletal system and overview of training and quality requirements)
Gassner, L., Hofer, V.
Osteopathische Medizin, 2023/06
Free full text
989

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
Free full text
990

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
Free full text
991

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
Free full text
992

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text
993

An Osteopathic Approach to Plagiocephaly in the Absence of Pre-Post Sphenoid Fusion
Rosten, C., Nixon, K., Jons-Cox, L.
The AAO Journal, 2023/06
Free full text
994

Releasing the Restriction: A Study of Myofascial Release to Improve Pain and Range of Motion in Post-Cesarean Section Patients in the Peruvian Amazon
Scott, G., Gordon, T.
The AAO Journal, 2023/06
Free full text
995

Expertenmeinungen zur viszeralen Osteopatie
(Experts' opinions on visceral osteopathy)
Newiger, C., Eichhorn, V.
Osteopathische Medizin, 2023/06
Free full text
996

Refractory Temporomandibular Joint Pain Resolved with Intraoral Osteopathic Manipulative Treatment
Shah, R., Drakeley, C., Mehra, R.
The AAO Journal, 2023/06
Free full text
997

Ultrasound Assessment of OMT on Diaphragm Motion
Snow, N., DeDi, C., Rathjen, S., Redden, D. T., Kozar, A., Robinson, L.
The AAO Journal, 2023/06
Free full text
998

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
Free full text
999

Symptomatic Mitigation of a Rare Case of Chronic Active Epstein-Barr Virus (CAEBV)Disease Using Lymphatic Osteopathic Manipulative Treatment
Song, Y., Waddington, M.
The AAO Journal, 2023/06
Free full text
1000

Approaching the barrier: Improved pediatric resident knowledge and confidence in osteopathic manipulative medicine after a resident-led educational intervention
Tyler, S., McMunn, R., Ruedinger, E.
The AAO Journal, 2023/06
Free full text
1001

Effects of Osteopathic Manipulative Treatment (OMT) on Functional Impairment in Limb Girdle Muscular Dystrophy Patient: A Case Report (271)
Unser, K., Yao, S.
The AAO Journal, 2023/06
Free full text
1002

Faszien als sensorisches und emotionales Organ: Emotionen, Faszien und Immunsystem
(Fasciae as sensory and emotional organ: Emotions, fasciae and immune system)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/06
Free full text
1003

Osteopathic Manipulative Medicine as an Adjuvant Treatment for Hemicrania Continua: A Case Study
Van Fossen, E., Kanithi, M., Jelneck, S., Ferguson, D., Tran, J., Bui, N., Hassan, D., Gordon, T.
The AAO Journal, 2023/06
Free full text
1004

A Case Study of Osteopathic Manipulative Treatment (OMT) in Deformational Plagiocephaly (DP)
Vega, K., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
1005

The Planetary Benefit of Suspending USMLE Step 2 CS: Estimating Carbon Emissions Associated with US Medical Students' Travel to Testing Centers
Sherpa, J. R., Donahue, L., Tsai, J., Nguemeni Tiako, M. J.
The Yale Journal of Biology and Medicine, 2023/06
Free full text
1006

Banging Out Concussions: The Role of Osteopathic Manipulative Treatment in Post-Concussion Syndrome in Children
Wajid, A., Ettlinger, H.
The AAO Journal, 2023/06
Free full text
1007

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06
1008

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text
1009

Effect of OMT on post-anoxic brain injury resulting in intractable myoclonus
Zhong, X., Campo, Z., Torrents, M.
The AAO Journal, 2023/06
1010

The first step to strengthening graduate level osteopathic education: a national review
Cain, R. A.
Journal of Osteopathic Medicine, 2023/06
Free full text
1011

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06
1012

OSCAR (Osteopathic Single CAse Research) – Assessing the effect of standard and biopsychosocial osteopathic management for patients with non-specific low back pain: Protocol for a Single Case Experimental Design (SCED)
Draper-Rodi, J., Abbey, H., Brownhill, K., Vogel, S.
International Journal of Osteopathic Medicine, 2023/06
1013

Influence of osteopathic correction on range of motion and quality of life in patients with arthrosis of the shoulder joint of I–II degrees
(Влияние остеопатической коррекции на объем движения и качество жизни у пациентов с артрозом плечевого сустава I–II степени)
Avzaletdinov, B. K., Akhmetov, B. H.
Russian Osteopathic Journal, 2023/06
Free full text
1014

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text
1015

Pressure force on tissues in various osteopathic techniques (pilot study
(Сила давления на ткани при различных остеопатических техниках (пилотное исследование)
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P., Smirnova, L. M., Kolyshnitsyn, N. Y., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/06
Free full text
1016

Physical health level and osteopathic status of students
(Уровень физического здоровья и остеопатический статус студентов)
Tyuleneva, A. A., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/06
Free full text
1017

The influence of general osteopathic treatment on the quality of life of elderly people
(Влияние общего остеопатического лечения на качество жизни людей пожилого возраста)
Usupbekova, B. S., Zhusupbekova, N. E., Shyikymanarov, E. S.
Russian Osteopathic Journal, 2023/06
Free full text
1018

The possibilities of osteopathic correction using for the treatment of children with attention deficit hyperactivity disorder
(Возможности применения остеопатической коррекции для лечения детей с синдромом дефицита внимания и гиперактивности)
Zaev, A. I., Stenkova, O. V.
Russian Osteopathic Journal, 2023/06
Free full text
1019

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06
1020

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
1021

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text
1022

Accompagner les changements curriculaires vers l’approche par compétences dans les formations en santé : étude d’une stratégie de changement pragmatique portée par un individu-tercéisateur dans un institut de formation en ostéopathie français
(Facilitating curricular changes towards the competency-based approach in health education : study of a pragmatic change strategy supported by a third-party with terceisation function in an osteopathic training institute)
Quesnay, P.
Unpublished PhD thesis, 2023/06
1023

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
1024

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
1025

What complementary and alternative medicine therapy recommendations exist across clinical practice guidelines for low back pain? A systematic review
Mohiuddin, U., Ng, J.
Journal of Complementary and Integrative Medicine, 2023/06
1026

Efectos del tratamiento osteopático en trastornos neurocognitivos asociados y la calidad de vida relacionada con la salud en el trastorno del espectro alcohólico fetal
(Effects of osteopathic treatment on associated neurocognitive disorders and health-related quality of life in fetal alcohol spectrum disorder)
Cases Solé, R.
Unpublished PhD thesis, 2023/06
Free full text
1027

Pharmacology Education, Osteopathic Principles Integration, Osteopathic Manipulation Treatment relations: Osteopathic Graduating Seniors' Perception
Eldeeb, K.
Journal of Pharmacology and Experimental Therapeutics, 2023/06
1028

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05
1029

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05
1030

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text
1031

The effect of cranial techniques on the heart rate variability response to psychological stress test in firefighter cadets
Wójcik, M., Siatkowski, I.
Scientific Reports, 2023/05
Free full text
1032

The Short-Term and Long-Term Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D. Y., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
1033

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05
1034

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
1035

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05
1036

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05
1037

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text
1038

Manejo de la espondilolistesis lumbar desde la osteopatía. Una revisión bibliométrica
(Management of lumbar spondylolisthesis from osteopathy. A bibliometric review)
Apolinar Cruz, G. A.
Unpublished MSc thesis, 2023/05
Free full text
1039

Effect of a Stress Management Module on First-Year Osteopathic Medical Students’ Stress Levels
Hill, Y. M.
Unpublished PhD thesis, 2023/05
1040

Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine
Alvarez, G., Lucas, S., Roura, S.
Journal of Osteopathic Medicine, 2023/05
Free full text
1041

Identifying Predictors of Eventual Rural Practice Among Female Osteopathic Medical Students
Kahl, D.
Unpublished Dissertation, 2023/05
1042

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/05
Free full text
1043

Perceptions of experienced osteopaths on interprofessional communication
Grech, R.
Unpublished MSc thesis, 2023/05
Free full text
1044

The Preferences of Osteopathy Patients, Students, and Osteopaths on the Patient-Centered Orientation in Osteopathic Care
Mendes, B.
Unpublished MSc thesis, 2023/05
Free full text
1045

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05
1046

Is there a mean difference in attitude when care for LGBTQ patients between primary care provider subgroups?
Doan, T.
Unpublished MSc thesis, 2023/05
Free full text
1047

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05
1048

Medical Education Fellowship: Who's Doing It and Why?
Cueva, J., Jobeun, N., Mody, S.
Western Journal of Emergency Medicine, 2023/05
Free full text
1049

The effectiveness of visceral osteopathy in pain, disability, and physical function in patients with low-back pain. A systematic review and meta-analysis
Ceballos-Laita, L., Mingo-Gómez, M. T., Medrano-de-la-Fuente, R., Hernando-Garijo, I., Jiménez-Del-Barrio, S.
Explore (NY), 2023/04
1050

Comment les ostéopathes enseignant en Suisse décrivent leur raisonnement ? clinique : Une étude phénoménologique descriptive
(How osteopaths teaching in Switzerland describe their clinical reasoning: A descriptive phenomenological study)
Very, A.
Unpublished MSc thesis, 2023/04
1051

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04
1052

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: Randomized controlled trial
Boas Fernandes, W. V., Politti, F., Blanco, C. R., Garcia Lucareli, P. R., Gomes, C. A. F. d. P., Corrêa, F. I., Corrêa, J. C. F.
Journal of Bodywork and Movement Therapies, 2023/04
1053

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match. Letter
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
Free full text
1054

A New Barrier in the Urology Residency Application Process For Students: Growth of U.S. Medical Schools Increasingly Outpaces the Development of Urology Programs
Nelwan, D., Donato, U., Patel, T., Imam, A. S.
The Journal of Urology, 2023/04
1055

Exploring the approaches used by New Zealand osteopaths to help promote exercise rehabilitation adherence
Whitford, P.
Unpublished MSc thesis, 2023/04
Free full text
1056

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
1057

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
1058

Realistic Assessment of Research Publications by Neurosurgery Residency Applicants
Hasley, H. L., O'Malley, G. R., Jr., Bala, S., Weisman, H. E., Roth
World Neurosurgery, 2023/04
1059

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text
1060

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text
1061

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text
1062

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
1063

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
1064

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
1065

Osteopathic Findings and Treatment of Patient with Crohn's Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
1066

Method for correcting somatic dysfunctions
(Метод коррекции соматических дисфункций)
Aptekar, I. A.
Russian Osteopathic Journal, 2023/03
Free full text
1067

The influence of osteopathic correction on liquorodynamics in patients with tension-type headache
(Влияние остеопатической коррекции на ликвородинамику у пациентов с головной болью напряжения)
Belash, V. O., Starostenko, V. A.
Russian Osteopathic Journal, 2023/03
Free full text
1068

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03
1069

Understanding and preference toward DOs and OMT before and after an osteopathic principles and practice fellow lecture series
Ellson, L., Wong, N., Harper, J., Williamson, G., Zapata, I., Putnam, K., Roberts, J.
Journal of Osteopathic Medicine, 2023/03
Free full text
1070

Interventional Radiology in Osteopathic Medical Education
Cyphers, E., Groskreutz, D., Grilli, C., Ahuja, R.
Journal of Vascular and Interventional Radiology, 2023/03
1071

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
1072

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
1073

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03
1074

Abwertung als Ziel: Über den Artikel „Die Scheinwirkung der Osteopathie” von Edzard Ernst
(Devaluation as a Goal: About the Article “The Sham Effect of Osteopathy“ by Edzard Ernst)
Franke, H.
Osteopathische Medizin, 2023/03
1075

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03
1076

A Case Study of Postural Imbalance with Lymphatic Congestion Which Responded to OMT
Lockhart, W. C.
The AAO Journal, 2023/03
Free full text
1077

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text
1078

Response to “Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine“
Rehman, Y., Kirsch, J., Snider, K. T.
Journal of Osteopathic Medicine, 2023/03
Free full text
1079

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03
1080

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03
1081

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
1082

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text
1083

Osteopathische Behandlung von Säuglingen mit infantiler Kolik/exzessivem Schreien: Eine prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of infants with infantile colic/excessive crying: A prospective, multicenter, controlled randomized trial.)
Zimmer, M., Göpfert, J., Laux, P., Langenmair, S.
unpublished D.O. thesis, 2023/03
1084

Goniometric effects of an osteopathic technique, active stretching with specific, fixation on the mobility of the Scapular Waist
(Гониометрическая оценка применения остеопатической техники активного вытяжения со специфической точкой фиксации. Влияние на подвижность плечевого пояса)
Campillar, M. A.
Russian Osteopathic Journal, 2023/03
Free full text
1085

Results of osteopathic correction according to the stabilography data in patients with lower limb amputation at the transtibial level
(Результаты остеопатической коррекции по данным стабилографии у пациентов с ампутацией нижних конечностей на уровне голени)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2023/03
Free full text
1086

Substantiation of the effectiveness of osteopathic correction in the treatment of patients suffering from post-puncture syndrome
(Обоснование эффективности остеопатической коррекции при лечении пациентов, страдающих постпункционным синдромом)
Krivenya, M. S., Gorobets, L. V.
Russian Osteopathic Journal, 2023/03
Free full text
1087

Results of the osteopathic treatment of the temporomandibular joint dysfunction (meta-analysis
(Результаты остеопатического лечения дисфункции височно-нижнечелюстного сустава (метаанализ)
Milutka, Y. A., Dyachkova, Y. Y., Evdokimova, A. V.
Russian Osteopathic Journal, 2023/03
Free full text
1088

The possibilities of using osteopathic correction for chronic pelvic pain syndrome
(Возможность применения остеопатической коррекции при синдроме хронической тазовой боли)
Sharapov, I. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/03
Free full text
1089

Russian Osteopathic Journal: the main stages of development in 2012–2022
(Российский остеопатический журнал: основные этапы развития в 2012–2022 гг.)
Tregubova, E. S., Plokhov, R. A., Potekhina, Y. P., Belash, V. O.
Russian Osteopathic Journal, 2023/03
Free full text
1090

Osteopathic rehabilitation of patients after community-acquired pneumonia
(Остеопатическая реабилитация пациентов, перенесших внебольничную пневмонию)
Usupbekova, B. S., Sartmyrzaeva, S. S., Murzakhmetova, S. A.
Russian Osteopathic Journal, 2023/03
Free full text
1091

Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis
(Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
Free full text
1092

Therapeutic and stabilization exercises after manual therapy in patients with non-specific chronic neck pain: A randomised clinical trial
Demir, O., Atıcı, E., Torlak, M. S.
International Journal of Osteopathic Medicine, 2023/03
1093

Substantiation of the application of osteopathic correction in the complex rehabilitation of patients after anterior cruciate ligament reconstruction surgery
(Обоснование применения остеопатической коррекции в комплексной реабилитации пациентов после операции реконструкции передней крестообразной связки)
Vorobyev, S. V., Dolinina, O. Y., Mokhov, A. D., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/03
Free full text
1094

Osteopathic intervention for infants with breastfeeding difficulty: A retrospective case series
Greenwood, K., Engel, R., Grace, S.
International Journal of Osteopathic Medicine, 2023/03
1095

Kann mittels Osteopathie der Hormonstatus von infertilen Frauen mit Polyzystischem-Ovarial-Syndrom (PCOS) beeinflusst werden?
(Is it possible to influence the hormone levels of infertile women with polycystic ovarian syndrome (PCOS) by osteopathic treatments?)
Hartl, V.
Unpublished MSc thesis, 2023/03
1096

Response to Lo et al. regarding “The role of 3D digital applications in Manual Therapy Education – A scoping review”
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2023/03
Free full text
1097

Letter to the editor, regarding: The role of 3D digital applications in manual therapy education – A scoping review
Lo, C. N.
International Journal of Osteopathic Medicine, 2023/03
1098

Osteopathic education: A scoping review protocol
MacMillan, A., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/03
1099

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03
1100

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03
1101

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
1102

Die klinische Wirksamkeit des Fasziendistorsionsmodells
(Clinical Efficacy of the Fascial Distortion Model)
Honc, C.
Unpublished MSc thesis, 2023/03
Free full text
1103

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
1104

The Early Impact of Deciding to Take the United States Medical Licensing Examination Step 1 for Osteopathic Medical Students in the Pass/Fail Era
Hedgepeth, D., Wlasowicz, S., Lott, R., Smith, T.
Cureus, 2023/03
Free full text
1105

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
1106

Osteopathie bei Frauen mit Blasenentleerungsstörung sowie Blasenspeicherstörungen
(Effect of osteopathy on bladder storage dysfunctions and voiding difficulties in women)
Schwarzenlander, U.
Unpublished MSc thesis, 2023/03
1107

Effektivität einer craniosacralen Behandlung bei Multiple-Sklerose-PatientInnen mit Störungen im Urogenitaltrakt im Vergleich zur physiotherapeutischen Behandlung mittels aktiver Beckenbodenübungen
(Effectiveness of a craniosacral treatment on patients with multiple sclerosis with problems of the urogenital system compared with pelvic floor training)
Karner, A.
Unpublished MSc thesis, 2023/03
1108

Effektivität von osteopathischen Techniken und Behandlungen bei COPD. Systematisches Review
(Effectiveness of osteopathic techniques and treatments in patients with COPD. A systematic review)
Safran, T.
Unpublished MSc thesis, 2023/03
1109

Die Wirksamkeit der Osteopathie auf die Okulomotorik nach einer Gehirnerschütterung
(The effectiveness of osteopathy on oculomotor function after concussion)
Dalder, K.
Unpublished MSc thesis, 2023/03
1110

Der Einfluss einer visceralen Behandlungstechnik auf die Beweglichkeit der Halswirbelsäule
(The influence of a visceral treatment technique on the mobility of the cervical spine)
Koch, K.
Unpublished MSc thesis, 2023/03
1111

Connecting the dots: alterations in bioelectric activity at acupuncture Ting (Jing-Well) points following CV4 cranial manipulation
Hendryx, J. T., Kannan, A., Prashad, J., Falk, K.
Journal of Osteopathic Medicine, 2023/03
Free full text
1112

Der Einfluss der Osteopathie auf infantile nicht-synostotische Plagiozephalie
(The Influence of Osteopathy on infantile non-synostotic Plagiocephaly)
Archam, S.
Unpublished MSc thesis, 2023/03
1113

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text
1114

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text
1115

Osteopathische Behandlung bei Rückenschmerzen. Akuter, nicht- spezifischer
(Osteopathic Manipulative Treatment for acute, non-specific Low Back Pain)
Jankovic-Preslmayer, M.
Unpublished MSc thesis, 2023/03
1116

Die Messung der vertikalen Sprunghöhe bei VolleyballerInnen nach einer osteopathischen Behandlung
(Vertical jump height of volleyball players after an osteopathic treatment)
Archer, K.
Unpublished MSc thesis, 2023/03
1117

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
1118

Pilot of an Interprofessional Functional Nutrition and Lifestyle Medicine Elective with Community Cooking Classes during Covid-19 Pandemic
Jones, G. M., Stevenson, T.
Journal of Integrative and Complementary Medicine, 2023/02
1119

An Update on Medical School Accreditation in the United States: Implications for the Single Graduate Medical Education (GME) Era
Ahmed, H., Kortz, M., Carmody, J. B.
Cureus, 2023/02
Free full text
1120

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
1121

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text
1122

Management of Post-Viral Postural Orthostatic Tachycardia Syndrome With Craniosacral Therapy
Tafler, L., Chaudry, A., Cho, H., Garcia, A.
Cureus, 2023/02
Free full text
1123

To the Editor: COMLEX-USA vs USMLE? Irrelevant
Terry, R., Lavertue, S.
Journal of Graduate Medical Education, 2023/02
Free full text
1124

The Impact of Complementary and Integrative Medicine Following Traumatic Brain Injury: A Scoping Review
Kim, S., Mortera, M. H., Wen, P. S., Thompson, K. L., Lundgren, K., Reed, W. R., Sasson, N., Towner Wright, S., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
The Journal of Head Trauma Rehabilitation, 2023/02
Free full text
1125

Abordaje de Manejo de dolor en Niños desde la perspectiva de la Medicina Alternativa
(Approach to Pain Management in Children from an Alternative Medicine Perspective)
Sierra Sánchez, A. P.
Unpublished MSc thesis, 2023/02
Free full text
1126

Effectiveness of osteopathic treatment in patients with Lower Urinary Tract Symptoms (LUTS)
Arora, A., Ghosh, T.
Biomedicine, 2023/02
1127

Einklemmungsphänomene als Ursache für eine Parese des N. abducens
(Entrapment phenomena as a cause of abducens nerve paresis)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
1128

Bedeutung des differenzierten Säuglingsbefunds
(Importance of the differentiated infant finding)
Ginsberg, I.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
1129

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
1130

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
1131

Historical Osteopathic Principles and Practices in Contemporary Care: An Anthropological Perspective to Foster Evidence-Informed and Culturally Sensitive Patient-Centered Care. A Commentary
Zegarra-Parodi, R., Baroni, F., Lunghi, C., Dupuis, D.
Healthcare, 2023/01
Free full text
1132

Neck pain service utilization and costs: association with timing of non-pharmaceutical services for individuals initially contacting a primary care provider. A retrospective cohort study
Elton, D., Zhang, M.
medRxiv, 2023/01
Free full text
1133

An exploration of the experience of osteopaths managing individuals with endometriosis
Zeigler, Z. L.
Unpublished MSc thesis, 2023/01
Free full text
1134

“It's all about the story”. Osteopaths' experiences of exploring menopausal symptoms: A qualitative interview study
Gelli, N., Abbey, H.
International Journal of Osteopathic Medicine, 2023/01
1135

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01
1136

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
1137

Including LGBTQIA+ Healthcare Education in the Pre-Clinical Curriculum at Osteopathic Medical Schools
Harrison, C. C.
Unpublished Dissertation, 2023/01
1138

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text
1139

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text
1140

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text
1141

What are the current rehabilitative approaches to ACL recovery post reconstruction surgery that osteopaths may implement?: A scoping review
Caughey, C.
Unpublished MSc thesis, 2023/01
Free full text
1142

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01
1143

Tratamento manipulativo osteopático em comparação com um programa de exercícios em corredores com Síndrome da dor patelofemoral : ensaio controlado randomizado
(Osteopathic manipulative treatment compared with an exercise program in runners with patellofemoral pain syndrome: randomized controlled trial)
Guglielmin, J. Z.
Unpublished PhD thesis, 2023/01
Free full text
1144

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text
1145

Revisión sistemática: análisis de la terapia osteopática en la tendinitis del manguito rotador
(Analysis of the efficacy of osteopathic therapy in the treatment of rotator cuff tendinitis. A systematic review)
Sanchez, C., Alexandra, Y.
Unpublished MSc thesis, 2023
Free full text
1146

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12
1147

Mental health outcomes among osteopathic physicians during COVID-19
Lee, E., Lo, Jo., Zhu, P., Fernandez Sweeny, Y., Fuchs, S.
International Journal of Osteopathic Medicine, 2022/12
Free full text
1148

The intersection of the two complimentary fields of preventive cardiology and integrative cardiology: A Fellow's voice
Cheung, B.
American Journal of Preventive Cardiology, 2022/12
Free full text
1149

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text
1150

COVID-19 in Patients with Asthma: Review and Implications for Care of Adult Patients with an Osteopathic Component
Frasca, D. J., Wolf, S.
Osteopathic Family Physician, 2022/12
Free full text
1151

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12
1152

A randomized, controlled study to assess if allopathic-osteopathic collaboration influences stereotypes, interprofessional readiness, and doctor-patient communication
Jones, I. A., LoBasso, M., Shapiro, J., Amin, A.
PLoS One, 2022/12
Free full text
1153

Die Geschichte der Osteopathie in Deutschland
(The history of osteopathy in Germany)
Engel, M.
Osteopathische Medizin, 2022/12
1154

Wirksamkeit der osteopathischen Behandlung bei pädiatrischen Beschwerden: Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manipulative treatment in pediatric complaints: A systematic review)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2022/12
Free full text
1155

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 2)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 2))
Klemm, S., Spiertz, M., Asche, M.
Osteopathische Medizin, 2022/12
1156

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
1157

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
1158

The Role of Osteopathic Manipulative Medicine in the Rehabilitation of a Competitive Dancer after a Major Abdominal Surgery
Berenbeim, G., Figueroa, J.
The AAO Journal, 2022/12
Free full text
1159

D.O.-Thesen im klinischen Bereich. Das neue Konzept der Akademie für Osteopathie AFO)
(D.O. Theses in the clinical area: The new concept of the Academy of Osteopathy (AFO))
Schwerla, F.
Osteopathische Medizin, 2022/12
1160

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 1)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 1))
Spiertz, M., Asche, M., Klemm, S.
Osteopathische Medizin, 2022/12
1161

Effects of osteopathic manipulative treatment associated with pain education and clinical hypnosis in individuals with chronic low back pain: study protocol for a randomized sham-controlled clinical trial
Luchesi, G. L. S., da Silva, A. K. F., Amaral, O. H. B., de Paula, V. C. G., Jassi, F. J.
Trials, 2022/12
Free full text
1162

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12
1163

Fascial Distortion Model (FDM) by Stephen Typaldos from the modern research and therapeutic concepts point of view
(Модель фасциальных дисторсий (FDM) Стивена Типальдоса с позиций современных исследований и терапевтических концепций)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. E., Agasarov, L. G.
Russian Osteopathic Journal, 2022/12
1164

Study of the possibility of osteopathic correction inclusion in the complex therapy of pelvic pain syndrome in women at the late postpartum period
(Исследование возможности включения остеопатической коррекции в состав комплексной терапии синдрома тазовой боли у женщин в позднем послеродовом периоде)
Chumakova, I. B., Nasibullina, R. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/12
1165

Substantiation of the possibility of using osteopathic correction in the complex treatment of patients with shoulder-shoulder pain syndrome
(Обоснование использования остеопатической коррекции в комплексном лечении пациентов с плечелопаточным болевым синдромом)
Emelyanova, C. K., Zolkova, O. V., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
1166

The use of autoimmunological parameters to evaluate the results of osteopathic correction: pilot study
(Использование аутоиммунологических показателей для оценки результатов остеопатической коррекции: пилотное исследование)
Ikhlef, A., Potekhina, Y. P., Tregubova, E. S., Kurbatov, O. I., Pukhalenko, A. I.
Russian Osteopathic Journal, 2022/12
1167

Application of infrared thermography in the study of the osteopathic correction results in patients with amputation defects of the lower extremities
(Инфракрасная термография в исследовании результатов остеопатической коррекции у пациентов с ампутационными дефектами нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2022/12
1168

The possibilities of osteopathic correction using in adolescents with varicocele: a pilot study
(Возможности применения остеопатической коррекции у подростков с варикоцеле: пилотное исследование)
Kutsebo, Y. V., Shchuchkina, E. A., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
1169

Osteopathic correction as part of the complex treatment of temporomandibular disorder
(Остеопатическая коррекция в составе комплексного лечения дисфункции височно-нижнечелюстного сустава)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2022/12
1170

Effects of osteopathic correction and the possibility of their study
(Эффекты остеопатической коррекции и возможности их исследования)
Potekhina, Y. P., Tregubova, E. S., Mokhov, D. E.
Russian Osteopathic Journal, 2022/12
1171

Osteopathic treatment of cervicalgia in dentists experiencing prolonged professional overloads
(Остеопатическое лечение цервикалгии у врачей-стоматологов, испытывающих продолжительные профессиональные перегрузки)
Usupbekova, B. S., Mombekova, S. A.
Russian Osteopathic Journal, 2022/12
1172

Epiploic Appendagitis Mimicking Acute Appendicitis: An Osteopathic Case Report
Chin, J., Oseguera, B., Hon, K., Lomiguen, C. M., McBride, T.
Cureus, 2022/12
Free full text
1173

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N. N., Eddy, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text
1174

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text
1175

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text
1176

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12
1177

A Case Study Examining Women in Leadership at a College of Osteopathic Medicine
Kelley, S.
Unpublished Dissertation, 2022/12
1178

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12
1179

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/12
Free full text
1180

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12
1181

The Touch Taboo: Origins for the Prohibition of Touch in Psychiatry and a Rational Osteopathic Approach
Huzij, T.
The AAO Journal, 2022/12
Free full text
1182

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12
1183

Effects of Osteopathic Manipulative Treatment on Primary Dysmenorrhea
Companion, N., Ahmed, E., Keys, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
1184

The Use of Osteopathic Manipulative Treatment (OMT) in the Management of Patients With Post-COVID Symptoms
Foss, V., Kaur, J., Stoukides, G., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
1185

Thomas L. Northup Lecture: Integrating Osteopathic Principles into Patient Care: An Approach for All Specialties
Snider, K.
The AAO Journal, 2022/12
Free full text
1186

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12
1187

A Feasibility Study to Assess OMT for NAS
Householder, L., Glynn, B., Wadman, H., Hoffmann, K.
Journal of Osteopathic Medicine, 2022/12
1188

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12
1189

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12
1190

Use of Osteopathic Manipulative Medicine in Treating Migraines
Lund, M., Pan, Y., Burns-Martin, J., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2022/12
1191

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12
1192

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12
1193

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12
1194

Impact of Osteopathic Manipulative Techniques on the Management of Dizziness Caused by Neuro-Otologic Disorders: Systemic Review and Meta-Analysis
Senger, B., Rehman, Y., Snider, K. T., Kirsch, J., Wang, M. Y.F., Johnston, R., Bingham, J., Ferguson, H., Swogger, S.
Journal of Osteopathic Medicine, 2022/12
1195

Osteopathic Manipulative Treatment Efficacy in Mean HIT-6 Score Reduction in Tension-Type Headaches: A Meta-Analysis
Tran, E., Thomas, C., Zheng, T., Thalody, A., Winegar, A., Torelli, V., Wu, S. S.
Journal of Osteopathic Medicine, 2022/12
1196

Efeitos do tratamento manipulativo osteopático nas manifestações musculoesqueléticas da fase crônica da febre Chikungunya : ensaio clínico randomizado
(Effects of osteopathic manipulative treatment on musculoskeletal manifestations in the chronic phase of Chikungunya fever: randomized clinical trial)
Tenório, L. C.
Unpublished MSc thesis, 2022/12
Free full text
1197

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/12
1198

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12
1199

Manual therapy as a management approach for gastroesophageal reflux disease: A systematic review
Brendon dos Santos, C., Artioli, D. P., Bertolinie, G. R. F.
International Journal of Osteopathic Medicine, 2022/12
1200

An exploration of the clinical reasoning used by registered osteopaths in their choice of therapeutic approach
Clifford, A., Segal, A., Guterres, A., Orrock, P. J.
International Journal of Osteopathic Medicine, 2022/12
1201

Approche somato-psychique de l'image du corps : Impact(s) d'une thérapie manuelle dans la prise en charge clinique de l'anorexie mentale sur les préoccupations corporelles
(Somato-psychic approach to body image: Impact(s) of a manual therapy in the clinical management of anorexia nervosa on bodily concerns)
Mattatia, J.
Unpublished PhD thesis, 2022/11
1202

Measuring the Perception of Readiness with an EHR Training: A Look into Primary Care
Saldivar, E.
Unpublished Dissertation, 2022/11
Free full text
1203

Preliminary Effects of Osteopathic Manipulative Medicine on Reactive Oxygen Species in Parkinson’s Disease: A Randomized Controlled Pilot Study
Docherty, J., Leheste, J. R., Mancini, J, Yao, S.
Cureus, 2022/11
Free full text
1204

The Austrian Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
van Dun, P. L. S., Arcuri, L., Verbeeck, J., Esteves, J. E., Cerritelli, F.
PLoS One, 2022/11
Free full text
1205

Physiotherapists and Osteopaths' Attitudes: Training in Management of Temporomandibular Disorders
Saran, S., Saccomanno, S., Petricca, M. T., Carganico, A., Bocchieri, S., Mastrapasqua, R. F., Caramaschi, E., Levrini, L.
Dentistry Journal, 2022/11
Free full text
1206

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
1207

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11
1208

A Systematic Review on Spinal Asymmetries in Case Studies of Unilateral Nephroptosis from a Viscerosomatic Point of View
Oliva-Pascual-Vaca, Á, Castillo-Cañuelo, M. J., Oliva-Pascual-Vaca, J., Pérez-Montalbán, M., Ordonez, F. J., Martínez-Fernández, J. A.
Healthcare, 2022/11
Free full text
1209

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11
1210

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text
1211

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/11
Free full text
1212

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text
1213

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
1214

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text
1215

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text
1216

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text
1217

Osteopathy in the Cranial Field as a Method to Enhance Brain Injury Recovery: A Preliminary Study
Dickerson, M., Murphy, S., Hyppolite, N., Brolinson, P. G., VandeVord, P.
Neurotrauma Reports, 2022/10
Free full text
1218

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text
1219

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text
1220

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/10
1221

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text
1222

Postoperative Osteopathic Manipulative Treatment in Children with Esophageal Atresia: Potential Benefits on the Anthropometric Parameters
Manzotti, A., Alati, A., Galli, M., Cerritelli, F., Leva, C., Alberti, A., Stizzoli, A., Costanzo, S., Canonica, C. P. M., Destro, F., Zuccotti, G., Calcaterra, V., Pelizzo, G.
Pediatric Reports, 2022/10
1223

Osteopathie in relatie tot menstruatieklachten bij een patiënte die lijdt aan endometriose en adenomyose. Een casestudie
(Osteopathy in relation to menstrual complaints in a patient who is suffering from endometriosis and adenomyosis. A case study)
den Braver- Scherpenzeel, M. R.
unpublished D.O. thesis, 2022/10
Free full text
1224

On “Manual Therapy in Preadolescent Children: A Delphi Investigation of Physical Therapists in the United States.“
Shear, D. L., Wetzler, G., Wisneski, L. A., Rasmussen, T. R.
Physical Therapy & Rehabilitation Journal, 2022/10
Free full text
1225

Effectiveness of cranial osteopathy therapy on nociception in equine back as evaluated by pressure algometry
Vokietytė-Vilėniškė, G., Nagreckienė, S., Duliebaitė, I., Žilaitis, V.
Acta Veterinaria Brno, 2022/10
Free full text
1226

Effect of Visceral Mobilization on Abdomino-Phrenic Dyssynergia in Irritable Bowel Syndrome Patients
Hammam, E. E. E.D., Sayed, A. A., Abdelkader, F., El-Moatasem, A. M.
The Egyptian Journal of Hospital Medicine, 2022/10
Free full text
1227

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1228

Chronischer Reizhusten in der osteopathischen Praxis
(Chronic dry cough in osteopathic practice)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1229

Traumasensible Vorgehensweise in der osteopathischen Praxis
(Trauma-sensitive approach in osteopathic practice)
Heuer, I., Tann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1230

Die Rolle der Osteopathie im Geburtsprozess – eine qualitative Studie
(The role of osteopathy in the birth process - a qualitative study)
Janisz, M., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1231

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
1232

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text
1233

Andrew Taylor Still lebt: Ent-wicklungslinien der osteopathischen Forschung und Lehre
(Andrew Taylor Still is alive: Lines of development of osteopathic research and teaching)
Levin, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1234

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
1235

Zirkumventrikuläre Organe und phänodynamische Osteopathie
(Circumventricular organs and phenodynamic osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
1236

Osteopathic status in people who have had a new coronavirus infection, 3–6 months after the disease
(Остеопатический статус лиц, перенесших новую коронавирусную инфекцию, через 3–6 мес после заболевания)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2022/09
1237

Justification of the use of osteopathic correction in the planned preparation of patients for general anesthesia with tracheal intubation
(Обоснование использования остеопатической коррекции при плановой подготовке больных к общей анестезии с интубацией трахеи)
Kurnoskin, V. L., Kurbatov, O. I.
Russian Osteopathic Journal, 2022/09
1238

Study of the effectiveness of osteopathic correction of the Ist toe valgus deformity of the I–II degree
(Исследование эффективности остеопатической коррекции вальгусной деформации I пальца стопы I–II степени)
Minakova, A. L., Ustinov, A. V.
Russian Osteopathic Journal, 2022/09
1239

Modern approaches to osteopathic diagnostics, its theoretical and practical foundations
(Современные подходы к остеопатической диагностике, её теоретические и практические основы)
Mokhov, D. E., Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2022/09
1240

The impact of osteopathic correction on the life quality of pregnant women
(Влияние остеопатической коррекции на качество жизни беременных)
Nenashkina, E. N.
Russian Osteopathic Journal, 2022/09
1241

Multidisciplinary approach in the treatment of chronic tension headache on the background of COVID-19
(Мультидисциплинарный подход при лечении хронической головной боли напряжения на фоне COVID-19)
Novikov, Y. O., Akopian, A. P., Amigues, F. A.
Russian Osteopathic Journal, 2022/09
1242

Effects of Balanced Ligamentous Osteopathic Technique over LV in low back pain
(Влияние остеопатической техники сбалансированного лигаментозного натяжения (BLT) на LV при люмбалгии)
Schenone, L. E.
Russian Osteopathic Journal, 2022/09
1243

Substantiation of the economic efficiency of the author′s manual repositioning method of the shoulder joint
(Обоснование экономической эффективности авторской мануальной методики вправления вывиха плеча)
Slabospitskii, M. A., Mokhov, D. E., Limarev, V. V., Tkachenko, P. V., Tkachenko, A. N., Mansurov, D. S., Khaydarov, V. M.
Russian Osteopathic Journal, 2022/09
1244

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
McCormick, M. E., Seideman, C. A.
The Journal of Urology, 2022/09
1245

The Portuguese osteopaths attitudes towards a biomechanical or biopsychosocial model in the approach of chronic low back pain – A cross-sectional questionnaire-based survey
Dinis, M., Silva, C., Cruz, R., Esteves, J., Nunes, A.
International Journal of Osteopathic Medicine, 2022/09
1246

The utilisation and attitudes to patient reported outcome measures by Australian osteopaths: A cross sectional study
Fleischmann, M., Fryer, G
International Journal of Osteopathic Medicine, 2022/09
1247

Case Report on Visceral Manipulation in Adolescent Idiopathic Scoliosis
Chahab, M., Donnet, P., Hernandez, D.
International Journal of Therapeutic Massage and Bodywork, 2022/09
1248

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text
1249

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
1250

OSTLIB – Die osteopathische Datenbank
(OSTLIB - The osteopathic database)
Franke, H.
Osteopathische Medizin, 2022/09
1251

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09
1252

Osteopathie als personenzentrierte und integrierende Behandlungsmethode – Teil 1
(Osteopathy as a person-centered and integrative treatment method - Part 1)
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/09
1253

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09
1254

The Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ) - A content validity study
Thomson, O. P., Vaughan, B., Sampath, K., Draper-Rodi, J., Fleischmann, M., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/09
1255

Osteopathische Medizin – Wo bleibt der Beweis?
(Osteopathic medicine - Where is the evidence?)
Schleusener, R.
Osteopathische Medizin, 2022/09
1256

Osteopathische Behandlung von Patienten mit episodischer Migräne. Prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of patients with episodic migraine. Prospective, multicenter, controlled randomized study)
Stolzmann, K., Ziller, M., Britz, I., de Braganca, L., Thielen, F.
Unpublished D.O. thesis, 2022/09
1257

Die Behandlung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr. Eine systematische Literaturrecherche
(The treatment of idiopathic asymmetry and positional plagiocephaly in infants in the first year of life. A systematic literature review)
Daake, B.
Unpublished D.O. thesis, 2022/09
1258

Osteopathische Behandlung von Frauen mit Beckengürtelschmerz post partum (PPGP). Randomisierte kontrollierte Studie
(To evaluate the effectiveness of custom tailored osteopathic treatment in women suffering from pelvic girdle pain after childbirth.)
Richterink, J., Bruns, A.
Unpublished D.O. thesis, 2022/09
1259

Lassen sich durch osteopathische Behandlungen von Patienten mit gastroösophagealem Reflux zusätzlich zur medikamentösen Standardbehandlung die Symptome verbessern? Randomisierte kontrollierte Studie
(Osteopathic treatment in addition to medical standard therapy in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial.)
Dannmeyer, A., Severin, F., Stisser, C.
Unpublished D.O. thesis, 2022/09
1260

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text
1261

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09
1262

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text
1263

Osteopathic Manipulative Treatment for Optic Pathway Glioma
Gordon, S., Hagopian, S.
The AAO Journal, 2022/09
Free full text
1264

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text
1265

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
1266

Effectiveness of Osteopathic Manipulation Treatment in the Rehabilitation of Post-External Immobilization for a Supracondylar Fracture of the Distal Humerus: A Case Report
Paiva, A., Bruntmyer, H. C.
The AAO Journal, 2022/09
Free full text
1267

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text
1268

Thoracic outlet syndrome due to first rib subluxation in a 69-year-old woman
Deveze, E., Daligault, M., Ammi, M., Picquet, J.
Annals of Vascular Surgery - Brief Reports and Innovations, 2022/09
Free full text
1269

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text
1270

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/08
Free full text
1271

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08
1272

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text
1273

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text
1274

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text
1275

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text
1276

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08
1277

Response to “Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine“
Marshall, S.
Journal of Osteopathic Medicine, 2022/08
Free full text
1278

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text
1279

Cranial osteopathic techniques and electroencephalogram (EEG) alpha power: a controlled crossover trial
Cella, M., Acella, E., Aquino, A., Pisa, V.
Journal of Osteopathic Medicine, 2022/08
Free full text
1280

Effectiveness of Osteopathic Treatment on the Spinal Column as Measured by the Spinal Mouse®: A Case Series
Colati, R., Pagano, A.
Cureus, 2022/08
Free full text
1281

Osteopathic Manipulative Treatment and the Management of Headaches: A Scoping Review
Jara Silva, C. E., Joseph, A. M., Khatib, M., Knafo, J., Karas, M., Krupa, K., Rivera, B., Macia, A., Madhu, B., McMillan, M., Burtch, J., Quinonez, J., Albert, T., Khanna, D.
Cureus, 2022/08
Free full text
1282

Effect of visceral manipulation on menstrual complaints in women with polycystic ovarian syndrome
Yosri, M. M., Hamada, H. A., Yousef, A. M.
Journal of Osteopathic Medicine, 2022/08
Free full text
1283

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text
1284

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/08
Free full text
1285

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
1286

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
1287

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
1288

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text
1289

Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020
Nikolla, D. A., Stratford, C. V., Bowers, K. M.
Journal of Osteopathic Medicine, 2022/07
Free full text
1290

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text
1291

Interventions non-pharmacologiques et syndrome de l’intestin irritable: revue de la littérature et méthodologie des essais thérapeutiques pour l’évaluation de l’efficacité de l’ostéopathie
(Nonpharmacological interventions and irritable bowel syndrome: review of the literature and methodology of therapeutic trials for the evaluation of the effectiveness of osteopathy)
Amsallem, F.
Unpublished PhD thesis, 2022/07
Free full text
1292

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07
1293

Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects
Gawrys, S. P., Bradshaw, J. T., Parker, L. M.
Journal of Osteopathic Medicine, 2022/07
Free full text
1294

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text
1295

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07
1296

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text
1297

Reduction and Resolution of a Hiatal Hernia Using Osteopathic Manipulative Treatment: A Case Report
Volokitin, M., Song, A., Peck, M. T., Milani, S.
Cureus, 2022/07
Free full text
1298

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07
1299

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07
1300

Resolution of rosacea-associated persistent facial edema with osteopathic manipulative treatment
Jay, R., Rodger, J.
JAAD Case Reports, 2022/07
Free full text
1301

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/07
1302

Response to “Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects“
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2022/07
Free full text
1303

Wirkung osteopathischer Behandlungen im 1. Lebensjahr
(Effect of osteopathic treatments in the 1st year of life)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
1304

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
1305

Non-pharmacological and non-surgical treatment of pain in children and adolescents with cerebral palsy: A scoping review
Flyckt, N., Wong, C., Michelsen, J. S.
Journal of Pediatric Rehabilitation Medicine, 2022/07
1306

Die Osteopathie aus Sicht der ärztlichen Osteopathen – eine qualitative Interviewstudie
(Osteopathy from the point of view of medical osteopaths - a qualitative interview study)
Waubert de Puiseau, A., Belz, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
1307

Técnicas osteopáticas para la liberación emocional: Monografía
(Osteopathic Techniques for Emotional Release: Monograph)
Vallecia Barragán, L. J.
Unpublished MSc thesis, 2022/07
Free full text
1308

Osteopathic Manipulative Treatment for Refractory Gastroesophageal Reflux Disease (GERD)
Yassin, K., Mutter, C., Waters, H., Mehra, R.
The AAO Journal, 2022/06
Free full text
1309

Holistic osteopathic approach to the care of veterans with post-traumatic stress disorder: Case report
Lovy, A., Berkowitz, M. R.
The AAO Journal, 2022/06
Free full text
1310

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text
1311

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text
1312

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
1313

Reply to Kudus, A.L. Comment on “Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845“
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2022/06
Free full text
1314

Chronic cough as seen by allergy specialists: An internet survey of providers in a large nation-wide practice
Prenner, Bruce M., Topp, Robert, McCan, William A.
Allergy and Asthma Proceedings, 2022/06
1315

Osteopathic treatment of newborns and infants: efficiency and associated risks (a systematic review of literature in English and in French
(Остеопатическое лечение новорожденных и грудных младенцев: эффективность и связанные с ним риски (систематический обзор англоязычной и франкоязычной литературы)
Maroye, L., Klein, P., Dethier, C., Dugailly, P.M.
Russian Osteopathic Journal, 2022/06
1316

No cuts, no buts: Satisfaction of first-year medical students with a hybrid prosection-based model for learning gross anatomy during the Covid-19 pandemic
Schurr, A. F., Burg, B. J., Dickinson, E., Granatosky, M. C.
Anatomical Sciences Education, 2022/06
1317

The use of osteopathic correction in the complex rehabilitation of patients with acute cerebrovascular accident
(Применение остеопатической коррекции в комплексной реабилитации пациентов с острым нарушением мозгового кровообращения)
Belash, V. O., Gritsay, E. O., Musina, T. S.
Russian Osteopathic Journal, 2022/06
1318

Osteopathic status of maternity patients after spinal anesthesia and the possibility of its correction
(Остеопатический статус родильниц после спинномозговой анестезии и возможности его коррекции)
Bobrova, A. S., Shkryabina, A. M., Khatkevich, A. K., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/06
1319

Comment on Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845
Kudus, A. L.
Life (Basel), 2022/06
Free full text
1320

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text
1321

Study of cervico-oral synergies in patients undergoing orthodontic treatment
(Исследование цервико-оральных синергий у пациентов, проходящих ортодонтическое лечение)
Milutka, Y. A., Basieva, E. V., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2022/06
1322

A Proposal for the Use of Craniosacral Therapy in Firefighter Cadets to Decrease Cortisol Levels and Improve Postural Stability—A Randomized Trial
Wójcik, M., Siatkowski, I., Żekanowska, E.
Journal of Men's Health, 2022/06
Free full text
1323

Osteopathy — a new direction of medicine (modern concept of Osteopathy
(Остеопатия — новое направление медицины (современная концепция остеопатии)
Mokhov, D. E., Potekhina, Y. P., Tregubova, E. S., Gurichev, A. A.
Russian Osteopathic Journal, 2022/06
1324

The possibility of osteopathic correction methods in the treatment of facial pain
(Возможность применения остеопатических методов коррекции в терапии лицевой боли)
Popov, A. S.
Russian Osteopathic Journal, 2022/06
1325

The influence of cultural philosophies on clinical practice of spinal manipulation: A comparison in Chinese manipulative therapy versus New Zealand osteopathy for the treatment of musculoskeletal disorders
Zhao, Y.
Unpublished MSc thesis, 2022/06
1326

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text
1327

Deutschsprachige Osteopathieliteratur: Eine Übersicht von der Entdeckung der Osteopathie bis zum Jahr 2000
(German-language osteopathic literature: a survey from the discovery of osteopathy to the year 2000)
Engel, M.
Osteopathische Medizin, 2022/06
1328

Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2021: Der INIOST-Studienreport 2021
(Overview of osteopathic studies published worldwide in 2021: The INIOST Study Report 2021.)
Franke, H.
Osteopathische Medizin, 2022/06
1329

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
1330

Durch dissipative Strukturierung zu Kohärenzgefühl und Gesundsein?
(Through dissipative structuring to a sense of coherence and being healthy?)
Pelz, H.
Osteopathische Medizin, 2022/06
1331

Die vier vegetativen Nervensysteme
(The four autonomic nervous systems)
Plathner, M.
Osteopathische Medizin, 2022/06
1332

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text
1333

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06
1334

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06
1335

Tongue stretching: technique and clinical proposal
Buscemi, A., Coco, M., Rapisarda, A., Frazzetto, G., Di Rosa, D., Feo, S., Piluso, M., Presente, L. P., Campisi, S. S., Desirò, P.
Journal of Complementary and Integrative Medicine, 2022/06
Free full text
1336

Psychosocial Interventions for the Treatment of Functional Abdominal Pain Disorders in Children: A Systematic Review and Meta-analysis
Gordon, M., Sinopoulou, V., Tabbers, M., Rexwinkel, R., de Bruijn, C., Dovey, T., Gasparetto, M., Vanker, H., Benninga, M.
JAMA Pediatrics, 2022/06
Free full text
1337

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
1338

Medical student research opportunities: a survey of osteopathic medical schools in the United States
Hamby, T., Wilson, D. P., Bui, P., Lowery, J., Basha, R.
Journal of Osteopathic Medicine, 2022/06
Free full text
1339

The Successful Use of Osteopathic Manipulative Treatment (OMT) for Positional Plagiocephaly: Now He's an Ambi-turner!
Harris, Z., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
1340

„Das philosophische Fundament Stills in die heutige Zeit überführen“
(“Bringing Still's philosophical foundation into the modern times.“)
Prediger, G., Buekens, J.
Osteopathische Medizin, 2022/06
1341

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text
1342

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text
1343

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text
1344

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text
1345

Effects of Organ System Courses of the First Two Years of Medical School on the Performance of the Comprehensive Osteopathic Medical Licensing Examination of the United States (COMLEX-USA) Level 2-Cognitive Evaluation
McNeil, K., Mashhouri, V., Christensen, P., Wang, H., Zhong, Q.
Cureus, 2022/06
Free full text
1346

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06
1347

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
1348

Relevance of historical osteopathic principles and practices in contemporary care: Another perspective from traditional/complementary and alternative medicine
Vogel, S., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
1349

An Osteopathic Manipulative Treatment (OMT) Evaluation and Treatment Protocol to Improve Gastrointestinal Function
Heineman, K.
The AAO Journal, 2022/06
Free full text
1350

Study of the osteopathic correction effectiveness of pectalgic syndrome in students
(Исследование эффективности остеопатической коррекции пекталгического синдрома у студентов)
Valiullova, L. V., Gilmutdinova, G. R., Safiullina, A. A.
Russian Osteopathic Journal, 2022/06
1351

Why I Became an FAAO and Why You Should As Well
Kessler, R.
The AAO Journal, 2022/06
Free full text
1352

Comparative analysis of osteopathic correction and standard comprehensive rehabilitation of patients with posttraumatic contractures of the upper limb joints
(Сравнительный анализ остеопатической коррекции и стандартной комплексной реабилитации пациентов с посттравматическими контрактурами суставов верхней конечности)
Zamanov, A. R., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2022/06
1353

Osteopathic Manipulation of Pelvic Floor Muscle Dysfunction Improves Chronic Lower Back Pain
Torres, J.
The AAO Journal, 2022/06
Free full text
1354

A study of consumer expectations and requirements for the quality of osteopathic services in parents of minor patients
(Исследование потребительских ожиданий и требований к качеству услуг по остеопатии у родителей несовершеннолетних пациентов)
Vinitskaya, T. V.
Russian Osteopathic Journal, 2022/06
1355

Response to Osteopathic Manipulative Treatment in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
Bomani-Bailey, A., Xu, T., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
1356

Variations in Average Cranial Rhythmic Impulse Rates
Crider, T., Grimm, J., Kozar, A., Tobey, A. H.
The AAO Journal, 2022/06
Free full text
1357

An Osteopathic Approach to Secondary Enuresis and Encopresis: Recovering Autonomic Stability
Goodman, F., Ammons, R., Gebhardt, G., Largent, J.
The AAO Journal, 2022/06
Free full text
1358

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
1359

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text
1360

The effect of longitudinal osteopathic experiences on family medicine resident confidence and utilization of osteopathic manipulative treatment
Matsushita, S., Lee, E., Pipitone, O., Vester, A.
The AAO Journal, 2022/06
Free full text
1361

Nurturing the Breath of Life: A Retrospective Analysis of the Effect of Osteopathic Manipulative Treatment on Patients Ventilated for COVID-19
Murphy, S., Mercer, A., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
1362

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text
1363

Picking Apples and Somatic Dysfunctions: A Case Study of Osteopathic Manipulative Treatment in the Farmworker Community
Ackerman, K., Gavin, K., Johnson, D.
The AAO Journal, 2022/06
1364

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text
1365

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Ahn, B., Martinez, E., Hadiprodjo, H., Jackson, C., Gutierrez, M., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Sanchez, J.
The AAO Journal, 2022/06
Free full text
1366

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text
1367

Upper Cross Syndrome and a Guarded Heart: Posture in a Case of Depression
Benzell, J. A., Abend, D., Bailey, J., Cooley, D., King Channell, M.
The AAO Journal, 2022/06
Free full text
1368

Osteopathic Manipulative Treatment of Individual with Intractable Singultus
Bloch, R., Kempa, M., Lippert, J.
The AAO Journal, 2022/06
Free full text
1369

SOAP Note Review: Evaluating Osteopathic Principles and Practice in Clinical Education
Budny, B., Gigliotti, D., Diggs, B., Fotopoulos, T., Johns, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
1370

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text
1371

Effects of Osteopathic Manipulative Treatment (OMT) on Anosmia and Ageusia in Post-COVID-19 Patient: A Case Report
Companion, N., Ventimiglia, M., Yao, S. C.
The AAO Journal, 2022/06
Free full text
1372

An Uncommon Cause of Common Peroneal Nerve Paresthesia: The Effect of Osteopathic Manipulative Treatment on Ganglion Cyst-Induced Common Peroneal Nerve Paresthesia
Cortes, M., Shah, N., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
1373

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
1374

Relief of Post-COVD-19 Burning Mouth Syndrome (BMS) with OMM- A case study
Frankini, E. L., Leder, A., Yao, S. C.
The AAO Journal, 2022/06
Free full text
1375

Blended Learning: Evaluating the effectiveness of various instructional methods
Garo, J. A., Dasar, Y., Nichols, M., Goering, E., Blumer, J.
The AAO Journal, 2022/06
Free full text
1376

A Guide for Transitioning Osteopathic Research from Medical School to Residency to Increase Research Productivity across Medical Training
Gober, C., Daly, E., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
1377

Body-Mind-Spirit Connection as an Approach to Treatment of Spasmodic Torticollis
Haley, L., Clark, M., Litman, R., Heller, G.
The AAO Journal, 2022/06
Free full text
1378

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
1379

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
1380

Effects of Osteopathic Manipulative Therapy on Temporomandibular Joint Disorders
Honeyman, J., Robke, B., Reed, G., Jacob, L., O'Donnell, M., Lynch, W. D., Moore, W.
The AAO Journal, 2022/06
Free full text
1381

Out of Place: An Osteopathic Approach to Recurrent Shoulder Dislocations in an Ehlers Danlos Patient
Lambros, S., Tuyn, D., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
1382

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
1383

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text
1384

Osteopathic Manipulative Treatment of the Deep Fascia for the Treatment of Chronic Trauma-induced Somatic Dysfunction
Nelson, C., Henderson, J., Kim, C., Le, B., Mintier, K.
The AAO Journal, 2022/06
Free full text
1385

The Soft Tissue Clinic Experience (SCTE): A sustainable way for early medical students to develop patient interaction and manipulative treatment skills
Ouyang, Z., Murphy, R., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
1386

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
1387

Establishing OMT as a Key Treatment Modality in Injury Rehabilitation: Teres Major Tear
Shah, N., Cortes, M., Posey, A.
The AAO Journal, 2022/06
Free full text
1388

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E., Bacon, C., Haile, Z. T., Walkowski, S. A.
The AAO Journal, 2022/06
Free full text
1389

Novel Lymphatic Counterstrain (LC) in a Case of Low Ankle Sprain
Trinh, D., Henderson, J., Goering, E.
The AAO Journal, 2022/06
Free full text
1390

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
1391

“Skateboard to the Head” A Case of Persistent Headaches Following Blunt Eye Trauma
Williams, D., Richie, C.
The AAO Journal, 2022/06
Free full text
1392

Restricted Shoulder Range of Motion: A Neglected Component That May Surprise You
Williams, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
1393

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
1394

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05
1395

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text
1396

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
1397

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text
1398

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
1399

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text
1400

The Importance of Pelvic and Leg Length Assessment in the Setting of Postpartum Lower Back Pain
Tafler, L., Wilson, D., Tafler, P.
Cureus, 2022/05
1401

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text
1402

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05
1403

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05
1404

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05
1405

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text
1406

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text
1407

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
1408

Interrater Reliabilität des 3 Phasen Tests
(Interrater reliability of the 3 phases test)
Grömer, M.
Unpublished MSc thesis, 2022/05
1409

Die Interrater-Reliabilität der Routineuntersuchung cranialer Dysfunktionen der vier Schädelzonen
(The Interrater-Reliability of the routine examination of cranial dysfunctions based on four skull zones)
Götz, T.
Unpublished MSc thesis, 2022/05
Free full text
1410

Evaluation de la qualité de la prise en charge ostéopathique de patientes souffrant de douleurs chroniques pelviennes dues à l'endométriose : une série de cas
(Assessing the quality of osteopathic management of patients with chronic pelvic pain due to endometriosis: a case series)
Litzistorf, S., Pires, N.
Unpublished MSc thesis, 2022/04
Free full text
1411

Sensibilisierung von Osteopath:innen in der Deutschschweiz gegenüber dem Thema Transidentität vor und nach der Lektüre eines Informationsblatts : qualitative Studie
(Sensitization of osteopaths in German-speaking Switzerland to the topic of trans identity before and after reading an information sheet : qualitative study)
Noser, M., Odermatt, C.
Unpublished MSc thesis, 2022/04
Free full text
1412

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text
1413

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text
1414

Exploring the Effects of Standardized Soft Tissue Mobilization on the Viscoelastic Properties, Pressure Pain Thresholds, and Tactile Pressure Thresholds of the Cesarean Section Scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Integrative and Complementary Medicine, 2022/04
Free full text
1415

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text
1416

Incidence Rate of Somatic Dysfunction in Previously Undiagnosed Spotted Fever Rickettsiosis: A Case Report
Unger, M. D., Palmer, J. L., Thorsvik, N. M.
Cureus, 2022/04
Free full text
1417

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
1418

The effect of osteopathic manipulative treatment on anaerobic performance and lactate clearance in male athletes: a double-blind, randomized, sham-controlled, crossover study
Akkaş, M. B., Belviranli, M., Okudan, N.
The Journal of Sports Medicine and Physical Fitness, 2022/04
1419

Osteopathic management of dysmenorrhea: A qualitative snapshot of New Zealand women’s experiences
Leys, A. E.
Unpublished MSc thesis, 2022/04
Free full text
1420

Having Heart: Affective and Cognitive Empathy Scores vs. Residency Specialty Match at an Osteopathic Medical School
Newton, B. W.
Medical Science Educator, 2022/04
1421

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
1422

Store-and-forward teledermatology impact on diagnosis, treatment and dermatology referrals: Comparison between practice settings
Pasadyn, S. R., McAfee, J. L., Vij, A., Warren, C. B.
Journal of Telemedicine and Telecare, 2022/04
1423

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text
1424

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text
1425

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) residency curriculum guidelines to meet Accreditation Council for Graduate Medical Education (ACGME) milestones
Balyakina, E. S., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2022/04
Free full text
1426

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/04
Free full text
1427

To Boost or Not to Boost: Acceptability of a COVID-19 Booster Dose among Osteopathic Medical Students: A Cross-Sectional Study from a Medical School in New York
Al Janabi, T., Pino, M.
Epidemiologia (Basel), 2022/04
Free full text
1428

A Review of Glymphatics and the Impact of Osteopathic Manipulative Treatment in Alzheimer's Disease, Concussions, and Beyond
Marino, M. A., Petrova, S., Sweiss, R., Duong, J., Miulli, D. E.
Cureus, 2022/03
Free full text
1429

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text
1430

Osteopathie bei Atopischer Dermatitis - eine randomisiert kontrollierte monozentrische explorative Studie
(Osteopathy in Atopic Dermatitis - a randomised controlled monocentric exploratory trial)
Ahnert, M. W.
Unpublished PhD thesis, 2022/03
Free full text
1431

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
1432

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text
1433

The effectiveness of rehabilitation of patients after covid pneumonia with osteopathic methods
(Эффективность реабилитации пациентов после перенесенной ковид-пневмонии методами остеопатии)
Belyaev, A. F., Fotina, O. N., Kharkovskaya, T. S., Yurchenko, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
1434

Long-term results of combined use of speech therapy and osteopathic correction in 5–6 year old children with dysarthria
(Отдаленные результаты совместного применения логопедической и остеопатической коррекции у детей 5–6 лет с дизартрией)
Bychkova, E. Y., Sandakov, A. V., Kuzmina, Y. O.
Russian Osteopathic Journal, 2022/03
Free full text
1435

Investigation of the osteopathic correction effectiveness in the treatment of pediatric patients with idiopathic scoliosis of the first degree
(Исследование эффективности остеопатической коррекции в лечении пациентов детского возраста с идиопатическим сколиозом I степени)
Kamaletdinov, V. L., Kamaletdinova, O. V., Safin, R. F.
Russian Osteopathic Journal, 2022/03
Free full text
1436

Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation
(Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
1437

Study of the combined use of osteopathic correction and EEG-biofeedback training in children with attention deficit hyperactivity disorder
(Исследование сочетанного применения остеопатической коррекции и ЭЭГ-БОС-тренингов у детей с синдромом дефицита внимания и гиперактивности)
Kudryashova, V. G., Chetverikova, N. A.
Russian Osteopathic Journal, 2022/03
Free full text
1438

Effects of osteopathic techniques of balancing SEB and separating the front-ethmoid suture in children with narrow palate
(Эффекты остеопатических методов уравновешивания сфенобазилярного синхондроза и разделения переднерешетчатого шва у детей с узким нёбом)
Quesada, B. M.
Russian Osteopathic Journal, 2022/03
Free full text
1439

Possibility of using osteopathic methods of correction in the treatment of myofascial pain syndrome
(Возможность применения остеопатических методов коррекции в терапии миофасциального болевого синдрома)
Safiullina, A. A., Safiullina, G. I.
Russian Osteopathic Journal, 2022/03
Free full text
1440

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
1441

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
1442

Impressionen von A.T. Stills Osteopathie
(Impressions of A.T. Stills osteopathy)
Stecker, D.
Osteopathische Medizin, 2022/03
1443

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1444

Study to assess existing knowledge of headache disorders among registered osteopaths practising in the UK: A cross-sectional survey
Huzzey-Cunningham, E., McWilliam, M., Mahtani, V., Bridge, H., Breukel, C., Schytz, H. W., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2022/03
1445

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text
1446

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text
1447

Osteopathic Approach to Treatment of Radial Head Dysfunction: The Radial Head Range of Motion Technique
Ellis, M. M., Lewis, D. D.
The AAO Journal, 2022/03
Free full text
1448

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text
1449

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text
1450

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text
1451

The Portuguese Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
Santiago, R. J., Nunes, A., Esteves, J. E., Cerritelli, F., Verbeeck, J., Lopes, S., Paquete, M., van Dun, P.
International Journal of Osteopathic Medicine, 2022/03
1452

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text
1453

Active learning in osteopathic education: Evaluation of think-pair-share in an undergraduate pathology unit
Wong, D.
International Journal of Osteopathic Medicine, 2022/03
1454

Results of osteopathic correction in children and adolescents with undifferentiated connective tissue dysplasia
(Результаты остеопатической коррекции у детей и подростков с недифференцированной дисплазией соединительной ткани)
Valiev, K. R., Vildanov, I. K., Zyatdinov, R. R., Gainullin, I. R.
Russian Osteopathic Journal, 2022/03
Free full text
1455

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1456

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1457

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
1458

Poster Award des Osteopathic Research Institute (ORI)
Poster award of the Osteopathic Research Institute (ORI)
Bohlen, L.
Osteopathische Medizin, 2022/03
1459

Nebennierendysfunktion als Schlüssel bei therapieresistentem Zervikalsyndrom: Ein Fallbericht
(Adrenal gland dysfunction as a key in therapy-resistant cervical syndrome: a case report.)
Ebner, M.
Osteopathische Medizin, 2022/03
1460

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
1461

Online-Konferenz: Osteopathie trifft Psychologie: 19.–20. November 2021
(Online Conference: Osteopathy Meets Psychology. November 19-20, 2021)
Richter, J.
Osteopathische Medizin, 2022/03
1462

Osteopathische Diagnostik und Behandlung funktioneller Gallenblasendyskinesien: Eine qualitative Interviewstudie
(Osteopathic diagnosis and treatment of functional gallbladder dyskinesia: A qualitative interview study)
Roth, P., Belz, S.
Osteopathische Medizin, 2022/03
1463

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text
1464

Interrater-Reliabilitätsstudie des allgemeinen osteopathischen Diaphragma-Schnelltests kranial der Symphysis pubica hinsichtlich Bewegung bei tiefer und tiefer abdominaler Inspiration
(Interrater reliability study of the general osteopathic diaphragm rapid test cranial to the symphysis pubica regarding movement during deep and deep abdominal inspiration)
Gärber, A.
Unpublished MSc thesis, 2022/03
1465

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03
1466

The AOA/ACGME Single Accreditation System and Its Immediate and Future Impact on Family Medicine
Fugazzi, L., Cummings, M.
Family Medicine, 2022/02
Free full text
1467

Osteopathische Medizin in vier chronischen muskuloskeletalen Schmerzerkrankungen: Eine Beobachtungsstudie mit Follow-up.
Osteopathic Medicine in Four Chronic Musculoskeletal Pain Diseases: An Observational Trial with Follow-Up
Rotter, G., Binting, S., Tissen-Diabaté, T., Ortiz, M., Brinkhaus, B.
Complementary Medicine Research, 2022/02
Free full text
1468

Inflammatory Biochemical Mediators and Their Role in Myofascial Pain and Osteopathic Manipulative Treatment: A Literature Review
Leicht, B. T., Kennedy, C., Richardson, C.
Cureus, 2022/02
Free full text
1469

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text
1470

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02
1471

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text
1472

Alimentación y osteopatía: el papel de la alimentación en el funcionamiento del sistema fascial. Revisión sistemática
(Diet and Osteopathy: The role of diet in the functioning of fascial system. Systematic Review)
Mora Mora, S. N.
Unpublished MSc thesis, 2022/02
Free full text
1473

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
1474

The Role of Advanced Academic Degrees in Orthopaedic Sports Medicine Faculty
Chen, A. Z., Greaves, K. M., Fortney, T. A., Ahmad, C. S., Levine, W. N., Trofa, D. P., Lynch, T. S.
Orthopaedic Journal of Sports Medicine, 2022/02
Free full text
1475

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02
1476

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text
1477

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text
1478

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text
1479

International Overview of Somatic Dysfunction Assessment and Treatment in Osteopathic Research: A Scoping Review
Tramontano, M., Tamburella, F., Farra, F., Bergna, A., Lunghi, C., Innocenti, M., Cavera, F., Savini, F., Manzo, V., D', Alessandro, G.
Healthcare, 2022/01
Free full text
1480

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text
1481

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
1482

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
1483

Inhibiting the Musculoskeletal Pathological Processes in Post-knee Replacement Surgery With Osteopathic Manipulative Treatment: A Systematic Review
Zhou, Y., Chin, J., Evangelista, A., Podger, B., Wan, P. J., Lomiguen, C. M.
Cureus, 2022/01
1484

20/20 Vision
Finch, T.
Health Communication, 2022/01
Free full text
1485

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text
1486

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01
1487

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text
1488

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01
1489

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text
1490

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
1491

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text
1492

Temporomandibulargelenk: Diskusverlagerung nach anterior
(Temporomandibular joint: disc displacement anteriorly)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
1493

Im Zwischen – eine am Leib orientierte osteopathische Besprechung
(In between - An osteopathic discussion oriented toward the body)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
1494

Osteopathische Behandlungsaspekte bei COVID-19
(Aspects of osteopathic treatment for COVID-19)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
1495

The Effect of Pedal Pump Lymphatic Technique Versus Passive Recovery Following Maximal Exercise: A Randomized Cross-Over Trial
DiFrancisco-Donoghue, J., Chan, T., Jensen, A. S., Docherty, J. E. B., Grohman, R., Yao, S. C.
Sports Medicine - Open, 2022/01
Free full text
1496

Anxiety among Adults Undergoing Elective Lumbar Spine Surgery at University of California – San Diego Medical Center – La Jolla
Rusinov, V.
Unpublished Dissertation, 2022/01
Free full text
1497

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text
1498

A New Zealand osteopathic perspective on the choice of working in an integrated care environment alongside other regulated health care providers: A qualitative descriptive study
Cox, V.
Unpublished MSc thesis, 2022
Free full text
1499

O papel das citocinas no apoio à monitorização e diagnóstico das condições alvo ao tratamento osteopático: Revisão sistemática da literatura
(The role of cytokines in supporting the monitoring and diagnosis of conditions targeted for osteopathic treatment: A systematic review of the literature)
Coelho, D.
Unpublished thesis, 2022
Free full text
1500

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text
1501

Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2020: Der INIOST-Studienreport 2020
(Review of osteopathic studies published worldwide in the year 2020: The INIOST Study Report 2020)
Franke, H.
Osteopathische Medizin, 2021/12
1502

Vagusaktivierung und Stressreaktion aus Sicht der Osteopathie
(Vagus activation and stress reactions from the point of view of osteopathy)
Liem, T.
Osteopathische Medizin, 2021/12
1503

Burnout und Stress – Korrelation mit viszeralem und kraniosakralem System
(Burnout and stress - Correlation with the visceral and craniosacral system)
Rössler, M., Kronstorfer, D.
Osteopathische Medizin, 2021/12
1504

Wissenschaft und Forschung in der Osteopathie: Teil 2: Forschung in der Osteopathie
(Science and research in osteopathy - Part 2: Research in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/12
1505

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12
1506

Osteopathic Manipulation of the Sphenopalatine Ganglia Versus Sham Manipulation, in Obstructive Sleep Apnoea Syndrom: A Randomised Controlled Trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2021/12
Free full text
1507

The effectiveness of orthodontic and osteopathic correction in patients with dental anomalies and musculoskeletal dysfunction of the temporomandibular joint in the presence of concomitant somatic dysfunctions and without it
(Эффективность ортодонтической и остеопатической коррекции у пациентов с зубочелюстными аномалиями и мышечно-суставными дисфункциями височно-нижнечелюстного сустава при наличии сопутствующих соматических дисфункций и без них)
Basieva, E. V., Milutka, Y. A., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2021/12
1508

Combined use of osteopathic correction and transcranial micropolarization of the brain in the treatment of children with attention deficit hyperactivity disorder
(Сочетанное применение остеопатической коррекции и транскраниальной микрополяризации головного мозга в лечении детей с синдромом дефицита внимания и гиперактивностью)
Belash, V. O., Bayer, D. V., Kostousov, V. V.
Russian Osteopathic Journal, 2021/12
1509

Osteopathic status in patients with new coronavirus infection COVID-19
(Остеопатический статус пациентов с новой коронавирусной инфекцией COVID-19)
Belash, V. O., Lisenkova, N. A.
Russian Osteopathic Journal, 2021/12
1510

The effect of osteopathic correction on the function of external respiration in patients after COVID-19 coronavirus pneumonia
(Влияние остеопатической коррекции на функцию внешнего дыхания у пациентов, перенесших коронавирусную пневмонию COVID -19)
Belyaev, A. F., Kharkovskaya, T. S., Fotina, O. N., Yurchenko, A. A.
Russian Osteopathic Journal, 2021/12
1511

Investigation of the possible effectiveness of osteopathic correction in the complex treatment of children in the first year of life with hip dysplasia
(Исследование возможной эффективности остеопатической коррекции в составе комплексного лечения детей первого года жизни с дисплазией тазобедренных суставов)
Fabristova, N. A., Gainullin, I. R.
Russian Osteopathic Journal, 2021/12
1512

Histological examination of cranial synchondroses as functionally significant elements in the cranial osteopathic concept
(Гистологическое исследование синхондрозов черепа, функционально значимых в краниальной остеопатической концепции)
Osipov, V. A., Pastukhov, A. N., Kurbatov, O. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/12
1513

Possibilities of osteopathic methods of diagnosis and correction in gallbladder dyskinesia
(Возможности применения остеопатических методов диагностики и коррекции при дискинезии желчного пузыря)
Panaseiko, Y. N.
Russian Osteopathic Journal, 2021/12
1514

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
1515

The immediate effect of harmonic therapy on peripheral blood flow in young males: A cross-over pilot study
Alsayani, K. Y. A., Aslan, U. B., Büker, N., Şavkın, R., Yağcı, A. B.
International Journal of Osteopathic Medicine, 2021/12
1516

Immediate alteration of the lumbar intervertebral foramen during the so-called osteopathic locking technique: A preliminary analysis on healthy subjects
Dugailly, P.M., Dethier, C., Salem, W.
International Journal of Osteopathic Medicine, 2021/12
1517

Use of muscle energy technique amongst a nationally representative sample of Australian osteopaths
Fryer, G., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2021/12
1518

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12
1519

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12
1520

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12
1521

How does French initial osteopathic training value relational competency, patient education, and the competency-based approach? A cross-sectional survey
Quesnay, P., Poumay, M., Gagnayre, R.
International Journal of Osteopathic Medicine, 2021/12
1522

Effects of Visceral Manipulation Treatment on Women with Infertility and Adults with Low Back Pain
Parker, A.
Unpublished Dissertation, 2021/12
1523

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12
1524

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) Residency Curriculum Guidelines to meet ACGME Milestones
Balyakina, E., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2021/12
1525

OMM alters chronic ethanolinduced changes to VTA GABA neurons, NAc DA release and measures of withdrawal in rats
Bills, K., Small, C., Otteson, D., Jones, G., Steffensen, S.
Journal of Osteopathic Medicine, 2021/12
1526

Serum osteocalcin in the osteopathic treatment for motor function in Parkinson’s Disease
Gupta, S., Lamba, S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2021/12
1527

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
1528

Factors Influencing Osteopathic Medical Students’ Decision to Pursue a Surgical Specialty
Keever, K., Kiernan, R. N., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12
1529

Factors Affecting Osteopathic Medical Students’ Specialty Choice in Light of a Future Pass/Fail COMLEX Level 1 and USMLE Step 1
Kiernan, R. N., Keever, K., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12
1530

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12
1531

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12
1532

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12
1533

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12
1534

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12
1535

The Importance of Dermatology Education During Osteopathic Preclerkship Curriculum
Tan, V., Schukow, C., Vitale, V., Restini, C.
Journal of Osteopathic Medicine, 2021/12
1536

Decreasing Headache Pain Secondary to a Subarachnoid Hemorrhage with the use of Osteopathic Manipulative Medicine
Barnes, P. L, Haas, H., Beck, B.
The AAO Journal, 2021/12
Free full text
1537

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text
1538

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text
1539

Effects of Compression of the 4th Ventricle (CV4) Treatment on Medical Student Anxiety
Goering, E., Herner, M., Smith, M., Galka, M., Kammerzell, S., Best, K., Anderson, P., Steinauer, M.
The AAO Journal, 2021/12
Free full text
1540

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text
1541

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11
1542

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text
1543

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text
1544

“If you don't use or understand visceral osteopathy you're not a real osteopath“: Professional identity in Australian osteopathy through the lens of a single traditional technique
Grace, S., Fleischmann, M., Vaughan, B.
Explore (NY), 2021/11
1545

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text
1546

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text
1547

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11
1548

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text
1549

Effect of osteopathic manipulation on gait asymmetry
Hill, C. N., Romero, M., Rogers, M., Queen, R. M., Brolinson, P. G.
Journal of Osteopathic Medicine, 2021/11
Free full text
1550

Der Einfluss der Osteopathie auf den Schmerz und die Beweglichkeit nach einer Rotatorenmanschettenrekonstruktion
(The influence of osteopathy on pain and mobility after rotator cuff reconstruction)
Schrempf, I.
Unpublished MSc thesis, 2021/11
1551

Die Auswirkungen einer allgemein osteopathischen Behandlung bei Patientinnen/Patienten mit rheumatoider Arthritis
(The effects of general osteopathic treatment on patients with rheumatoid arthritis)
Sommeregger, B. M.
Unpublished MSc thesis, 2021/11
1552

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11
1553

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11
1554

Les bienfaits de l’ostéopathie sur la constipation
(The benefits of osteopathy on constipation)
Pitel, C., Rojot, A.
Pratiques en Nutrition, 2021/11
1555

Response to Alvarez et al
Coste, J., Medkour, T., Maigne, J. Y., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/11
Free full text
1556

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text
1557

Wirksamkeit osteopathischer Behandlungen von Craniomandibulärer Dysfunktion bei Tinnitus Systematsiches Review
(Efficacy of osteopathic treatments for craniomandibular dysfunction in tinnitus. A Systematic Review)
Pollak, E.
Unpublished MSc thesis, 2021/11
1558

Der Einfluss von osteopathischen Behandlungen auf die Beschwerdesymptomatik bei Patienten mit CPPS als Ergänzung zur konventionellen Therapie
(The influence of osteopathic treatments on symptomatology in patients with CPPS as an addition to conventional therapy)
Nezaj, B.
Unpublished MSc thesis, 2021/11
1559

Osteopathie bei chronischen Beckenschmerzen
(Osteopathic treatment in patients with chronic pelvic pain)
Koza, M.
Unpublished MSc thesis, 2021/11
1560

Effektivität osteopathischer Behandlungen der Osteitis pubis bei männlichen Amateurfußballspielern im Vergleich zum Goldstandard
(Effectiveness of osteopathic treatments of osteitis pubis in male amateur soccer players in comparison to the gold standard)
Klima, C
Unpublished MSc thesis, 2021/11
1561

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
1562

Predictors for Actual COVID-19 Vaccine Uptake and Intended Booster Dosage among Medical Students of an Osteopathic Medical School in New York
Al Janabi, T., Pino, M.
Epidemiologia (Basel), 2021/11
Free full text
1563

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11
1564

A Missing Voice: The Lingual Complex and Osteopathic Manual Medicine in the Context of Five Osteopathic Models
Bordoni, B., Escher, A. R.
Cureus, 2021/10
Free full text
1565

As bases teóricas e práticas para o desenvolvimento da osteopatia
(The theoretical and practical foundations for the development of osteopathy)
Neves, S. C.
Unpublished PhD thesis, 2021/10
Free full text
1566

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
1567

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text
1568

Association Between the Modalities of Complementary and Alternative Medicine Use and Cost-Related Nonadherence to Medical Care Among Older Americans: A Cohort Study
Zhang, J. X., Meltzer, D. O.
The Journal of Alternative and Complementary Medicine, 2021/10
1569

Most common infant health concerns in osteopathic practices in Germany. A survey
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2021/10
1570

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text
1571

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text
1572

Osteopathy as a method of correction and prevention of the formation of somatic dysfunctions of the musculoskeletal system in office workers
(Остеопатия как метод коррекции и профилактики формирования соматических дисфункций опорно-двигательного аппарата у офисных работников)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2021/10
Free full text
1573

Evaluation of the clinical effectiveness of the osteopathic correction in children with chronic bronchitis in a sanatorium
(Оценка клинической эффективности остеопатической коррекции у детей с хроническим бронхитом в условиях санатория)
Belash, V. O., Khaibullina, G. A.
Russian Osteopathic Journal, 2021/10
Free full text
1574

Post-intensive care syndrome (PICS) in children
(Синдром последствий интенсивной терапии (ПИТ-синдром) у детей)
Karimova, L. K., Belash, V. O.
Russian Osteopathic Journal, 2021/10
Free full text
1575

Study of the effectiveness of osteopathic correction in the complex treatment of patients with operated primary open-angle glaucoma
(Исследование эффективности остеопатической коррекции в комплексном лечении больных с прооперированной первичной открытоугольной глаукомой)
Zubkov, O. V., Smirnova, E. A., Kramar, V. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2021/10
Free full text
1576

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2021/10
1577

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10
1578

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10
1579

Wirksamkeit der Osteopathie bei Depressionen als Begleitsymptom chronischer Erkrankungen: Systematic Review
(The Effect of Osteopathy on Comorbid Depression in Chronic Disease: Systematic Review)
Zajicek, M.
Unpublished MSc thesis, 2021/10
Free full text
1580

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text
1581

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text
1582

Osteopathic Treatment of Infants in Their First Year of Life: A Prospective Multicenter Observational Study (OSTINF Study)
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Complementary Medicine Research, 2021/10
Free full text
1583

Palpation of the Respiratory System in Osteopathic Manual Medicine: From the Trachea to the Lungs
Bordoni, B., Escher, A. R.
Cureus, 2021/09
Free full text
1584

Geist-Körper-Interdependenz in der osteopathischen Behandlung
(Mind-body interdependence in osteopathic treatment)
Liem, T., Van Den Heede, P.
Osteopathische Medizin, 2021/09
1585

Osteopathische Überlegungen zur Begleitung der Therapie des Mammakarzinoms
(Osteopathic considerations to support the therapy of breast carcinoma)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1586

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1587

Behandlung bei posttraumatischer Belastungsstörung
(Treatment for post-traumatic stress disorder)
Treu, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1588

Klassische Osteopathie – ein ganzheitlicher Ansatz
(Classical osteopathy - a holistic approach)
Williams, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1589

General Osteopathic Treatment (GOT) – ein Überblick
(General Osteopathic Treatment (GOT) - an overview)
Schiller, B.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
1590

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
1591

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text
1592

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09
1593

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09
1594

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09
1595

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09
1596

Wissenschaft und Forschung in der Osteopathie: Teil 1: Der Begriff der Wissenschaft in der Osteopathie
(Science and research in osteopathy - Part 1: The concept of science in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/09
1597

Osteopathic Cranial Manipulation for a Patient With Whiplash-Associated Disorder: A Case Report
Parravicini, G., Ghiringhelli, M.
Journal of Chiropractic Medicine, 2021/09
1598

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text
1599

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text
1600

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09
1601

Pain and symptom management in a case of cervical dystonia with comorbid generalized joint hypermobility using prolotherapy with osteopathic manipulative medicine
Mancini, J., Whitfield, D.
Movement Disorders, 2021/09
1602

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
1603

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09
1604

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 1: Philosophisch-ethischer Hintergrund
(Cognitive skills and professional roles of osteopaths according to A.T. Still - Part 1: Philosophical-ethical background)
Engel, M., Krause, K. C.
Osteopathische Medizin, 2021/09
1605

Meaning Construction for Biodynamic Osteopathy Terms in Translation Practice
Kalinina, I.
Taikomoji Kalbotyra, 2021/09
Free full text
1606

Nebenwirkungen nach einer osteopathischen Behandlung. Eine quantitative Fragebogenstudie
(Adverse Events After Osteopathic Treatment. A Quantitative Questionnaire Study)
Kloibhofer, M.
Unpublished MSc thesis, 2021/09
1607

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text
1608

Single Osteopathic Manipulative Treatment Session Eliminates Percutaneous Coronary Intervention-Induced Upper Thoracic Pain in Elderly Male
Hoffman, P., Belogorodsky, D., Noto-Bell, L.
The AAO Journal, 2021/09
Free full text
1609

Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/09
Free full text
1610

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text
1611

Wertesysteme in der osteopathischen Palpation – Gespräche mit OsteopathInnen über subjektive Wertesysteme in der osteopathischen Befundung und Behandlung
(Value systems in osteopathic palpation – Interviews with osteopaths about subjective value systems in osteopathic diagnosis and treatment)
Müller, F.
Unpublished MSc thesis, 2021/09
Free full text
1612

Interrater Reliabilitätstestung des Flexionstests der ersten Rippe bei symptomatischen und asymptomatischen Erwachsenen
(Interrater reliability of the flexion test for the first rib in symptomatic and asymptomatic adults)
Kondler, V.
Unpublished MSc thesis, 2021/09
1613

Wie stellt sich die Gesundheitsstörung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr in Bezug auf die Therapie dar? Eine systematische Literaturrecherche
(How does the health disorder of idiopathic asymmetry and posi-tional plagiocephaly in infants in the first year of life relate to therapy? A systematic literature review)
Daake, B.
Unpublished MSc thesis, 2021/09
1614

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09
1615

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text
1616

(Osteopoathic medical treatment of pediatric patient)
Angersbach, N.
Unpublished MSc thesis, 2021/09
1617

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text
1618

Osteopatia na atenção primária à saúde: resultados parciais de uma experiência de educação permanente e alguns efeitos iniciais.
Osteopathy in primary health care: partial results of continuing education experience and some initial outcomes
Schneider, L. M., Tesser, C. D.
Ciencia & Saude Coletiva, 2021/09
Free full text
1619

Osteopaths’ Perspectives on Patient Adherence to Self-Management Strategies: A Qualitative Content Analysis
Tripodi, N., Krajina, T., Lea, N., Giudice, H., Eskaf, S., Ojea, M., D&rsquo, Souza, T., McLeod, G., Feehan, J.
International Journal of Osteopathic Medicine, 2021/09
1620

Erratum: Vertigo and balance disorders - The role of osteopathic manipulative treatment: A systematic review (Complementary Medicine Research (2020) DOI: 10.1159/000512673)
Tramontano, M., Consorti, F., Morone, G., Lunghi, C.
Complementary Medicine Research, 2021/08/01
1621

Practicing Medicine in Underserved Areas: Differences that Make a Difference in Vocational Anticipatory Socialization
Walker, T. M.
Unpublished PhD thesis, 2021/08
Free full text
1622

Practitioner and practice characteristics of Australian osteopaths who discuss lifestyle factors with patients: Findings from a national practice-based research network
Adams, J., Sibbritt, D., Steel, A., Peng, W.
Health & Social Care in the Community, 2021/08
1623

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08
1624

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R, Boutron, I.
JAMA Internal Medicine, 2021/08
1625

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08
1626

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text
1627

Patient-centered care or osteopathic manipulative treatment as mediators of clinical outcomes in patients with chronic low back pain
Licciardone, J. C., Aryal, S.
Journal of Osteopathic Medicine, 2021/08
Free full text
1628

Single Accreditation Does Not Mean Double Jeopardy for Osteopathic Medical Students
Gimpel, J. R.
Academic Medicine, 2021/08
Free full text
1629

Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2021/08
Free full text
1630

An investigation of osteopaths’ attitudes and self-reported practices towards psychosocial content in sports-injury rehabilitation
Ferguson, S.
Unpublished MSc thesis, 2021/08
Free full text
1631

Arkansas College of Osteopathic Medicine Simulated Emergency Response Team: A Student Driven Pilot Program
Newman, C. W., Ackerman, R., Brown, T., Ramsey, H., Spector, D., Carson, J., Sanders, K., Daniels, D., Potts, H.
Southern Medical Journal, 2021/08
1632

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text
1633

Implications of the United States Medical Licensing Examination Step 1 Examination Transition to Pass/Fail on Medical Students Education and Future Career Opportunities
Ehrlich, H., Sutherland, M., McKenney, M., Elkbuli, A.
The American Surgeon, 2021/08
1634

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V. K., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/08
Free full text
1635

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, Marco, Consorti, Giacomo, Morone, Giovanni, Lunghi, Christian
Complementary Medicine Research, 2021/08
1636

White Coat Remediation: Understanding Medical Students’ Academic Remediation Experiences
Daly, L. E.
Unpublished PhD thesis, 2021/08
Free full text
1637

Reconsidering the Role of Synchronous Feedback in Learning Diagnostic Skills: Identifying the Impact of the Instructor
Jarman, S.
Unpublished MSc thesis, 2021/07
Free full text
1638

The Lymphatic System: An Osteopathic Review
Hruby, R. J., Martinez, E. S.
Cureus, 2021/07
Free full text
1639

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
1640

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
1641

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
1642

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07
1643

Osteopathic Principles and Practice: Essential Training for the Primary Care Physician of Today and Tomorrow
Misra, S.
Family medicine, 2021/07
Free full text
1644

Modulation of vestibulo-ocular reflex gain-symmetry induced by osteopathic manipulations on the fascial system in young healthy subjects: A three-arm randomized controlled trial
Romagnoli, M., Ntino, A. T., Galli, M., Origo, D.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2021/07
1645

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07
1646

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07
1647

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text
1648

Estimation of the efficiency of treatment of somatic dysfunctions of the pelvis bones using the technology of computer stabilography with biological feedback
(Оценка эффективности лечения соматических дисфункций костей таза с применением компьютерной стабилографии с биологической обратной связью)
Andreev, V. V., Sychev, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
1649

Possibility of osteopathic correction in the complex therapy of patients with Parkinson′s disease
(Возможность применения остеопатической коррекции в комплексной терапии пациентов с болезнью Паркинсона)
Belash, V. O., Batenina, A. M., Machulina, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
1650

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text
1651

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text
1652

Possibility of osteopathic correction inclusion in the complex treatment of anal incontinence in teenagers
(Возможность включения остеопатической коррекции в комплексное лечение недостаточности анального сфинктера у подростков)
Kovalchuk, T. S., Enaleev, R. R., Kuzmina, Y. O.
Russian Osteopathic Journal, 2021/07
Free full text
1653

Effectiveness of osteopathic care in the treatment of infant positional posterior plagiocephaly
(Эффективность остеопатического подхода в лечении задней плагиоцефалии позиционного происхождения у грудного ребенка)
Marangelli, G., Adouard, J., Josse, B., Ducourneau, J., Chastagner, A.S., Messien, C.
Russian Osteopathic Journal, 2021/07
Free full text
1654

Study of the peculiarities of the osteopathic status in patients with planovalgus deformity of the feet in combination with a history of placement torticollis and without such a combination
(Исследование особенностей остеопатического статуса у пациентов с плосковальгусной деформацией стоп в сочетании с установочной кривошеей в анамнезе и без такого сочетания)
Mukhammadieva, Y. R., Alshina, A. N., Gainetdinov, I. I., Safin, R. F.
Russian Osteopathic Journal, 2021/07
Free full text
1655

Adverse childhood experiences and trauma informed care: treating the whole patient with a more complete osteopathic approach
Marcoux, T. B.
Journal of Osteopathic Medicine, 2021/07
Free full text
1656

Possibility of using of osteopathic methods of correction in the therapy of symphysiopathy in pregnant women
(Возможность применения остеопатических методов коррекции в терапии симфизиопатии у беременных)
Nenashkina, E. N., Belash, V. O.
Russian Osteopathic Journal, 2021/07
Free full text
1657

Cultural self-awareness: An analysis of the cultural self-awareness in student osteopaths at the Unitec Institute of Technology in Aotearoa/New Zealand
Solomon, C.
Unpublished MSc thesis, 2021/07
Free full text
1658

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07
1659

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
1660

The efficacy of complementary and alternative medicine methods for chronic epilepsy in pediatric patients: A prisma systematic review and meta-analysis
Johnson, B.
Unpublished MSc thesis, 2021/07
Free full text
1661

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text
1662

The use of visceral techniques in Australian osteopathic practice: A descriptive cross-sectional study
Fleischmann, M., Vaughan, B., Grace, S., Stewart, A., Hart, C., Brew, E., Masters, G., Smeeton, L., Thompson, L., Brooks, M.
Advances in Integrative Medicine, 2021/07
1663

Osteopathic empirical research: a bibliometric analysis from 1966 to 2018
Morin, C., Gaboury, I.
BMC Complementary Medicine and Therapies, 2021/07
Free full text
1664

Conceptions de la santé et de la pratique des manipulations vertébrales d’étudiants en ostéopathie au cours de leur formation
(Conceptions of health and spinal manipulation practice of osteopathic students during their training)
Javerliat, P.
Unpublished PhD thesis, 2021/06
Free full text
1665

“Understanding patients' narratives” A qualitative study of osteopathic educators’ opinions about using Medical Humanities poetry in undergraduate education
Maretic, S., Abbey, H.
International Journal of Osteopathic Medicine, 2021/06
1666

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
1667

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text
1668

The development and application of a remediation process in an osteopathic curriculum
Aubin, A., Boulanger, C., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2021/06
1669

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
1670

An international profile of the practice of osteopaths: A systematic review of surveys
Ellwood, J., Carnes, D.
International Journal of Osteopathic Medicine, 2021/06
1671

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06
1672

Туннельная невропатия локтевого нерва: влияние остеопатической коррекции на снижение болевого синдрома
(Cubital tunnel neuropathy: Impact of osteopathic manipulative treatment on pain syndrome relief)
Belyaev, A. F., Belomestnov, P. V.
Russian Journal of Pain, 2021/06
Free full text
1673

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text
1674

Albrecht Kaisers Appell wird nicht gehört
(Albrecht Kaiser's appeal is not heard)
Sonntag, M.
Osteopathische Medizin, 2021/06
1675

Establishing osteopathic assessments to fulfill osteopathic recognition standards: a model for dermatology and other subspecialties
Mahlberg, S. J., Liou, Y. L., Lloyd, J.
Journal of Osteopathic Medicine, 2021/06
Free full text
1676

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
1677

Ersthelferinnen mit posttraumatischer Belastungsstörung: Auswirkung einer globalen osteopathischen Behandlung
(Female first responders with post-traumatic stress disorder: Effect of a global osteopathic treatment)
König, V.
Osteopathische Medizin, 2021/06
1678

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
1679

The Pediatric Workforce: Recent Data Trends, Questions, and Challenges for the Future
Vinci, R. J.
Pediatrics, 2021/06
1680

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06
1681

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text
1682

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text
1683

Crochet the Pain Away: A Case Study of Osteopathic Manipulation for Cervical Rib Induced Thoracic Outlet Syndrome
Herring, J. A., Soto, G. N., Silver, S.
The AAO Journal, 2021/06
Free full text
1684

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text
1685

Integrating Osteopathic Evaluation and Treatment in a Case of Opioid-Induced Hyperalgesia
Rosendahl, N. O.
The AAO Journal, 2021/06
Free full text
1686

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text
1687

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06
1688

Craniosacral Therapy Use in Normal Pressure Hydrocephalus
Park, Y., Kabariti, J., Tafler, L.
Cureus, 2021/05
Free full text
1689

Osteopathic Manipulative Treatment of Herpes Zoster Ophthalmicus/Postherpetic Neuralgia
Volokitin, M., Izadi, N., Myers, R., Kane Diaw, N., Milani, S.
Cureus, 2021/05
Free full text
1690

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text
1691

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text
1692

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05
1693

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2021/05
Free full text
1694

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05
1695

The Rule of Three
Abend, D.
Osteopathic Family Physician, 2021/05
Free full text
1696

Effects of CranioSacral Therapy upon Symptoms of Post-Acute Concussion and Post-Concussion Syndrome: A Pilot Study
Kratz, S. V., Kratz, D. J.
Journal of Bodywork and Movement Therapies, 2021/05
1697

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
1698

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
1699

The usage of multidisciplinary physical therapies at the Rio de Janeiro 2016 Olympic Summer Games: an observational study
Grant, M. E., Steffen, K., Palmer, D.
Brazilian Journal of Physical Therapy, 2021/05
Free full text
1700

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text
1701

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05
1702

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05
1703

Effects of Osteopathic Manipulative Treatment on Parkinsonian Gait: A Statistical Parametric Mapping Analysis
Terrell, Z. T.
Unpublished MSc thesis, 2021/05
1704

Beeinflussung abdominaler Adhäsionen durch osteopathische oder manuelle Techniken
(Influencing abdominal adhesions through osteopathic or manual techniques: A systematic review)
Kreuzer, M.
Unpublished MSc thesis, 2021/05
Free full text
1705

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05
1706

The Effectiveness of Pump Techniques and Pompages: A Systematic Review
Vanti, C., Golfari, M., Pellegrini, G., Panizzolo, A., Turone, L., Giagio, S., Pillastrini, P.
Applied Sciences, 2021/05
Free full text
1707

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text
1708

The use of osteopathic manipulative treatment in the newborn nursery and its effect on health in the first six months of life: A retrospective observational case-control study
Mills, M. V.
Complementary Therapies in Clinical Practice, 2021/05
Free full text
1709

Evaluation du rôle de l'ostéopathie dans la prévention et la prise en charge de la sarcopénie chez les personnes de plus de 65 ans
(Evaluation of the role of osteopathy in the prevention and management of sarcopenia in people over 65 years of age)
Gonthier, M., Jordan, L.
Unpublished MSc thesis, 2021/04
Free full text
1710

Quels sont les modèles utilisés par les ostéopathes dans leur pratique pour interpréter leurs perceptions lors d’un test palpatoire fascial, viscéral et crânien ?
(What models do osteopaths use in their practice to interpret their perceptions during fascial, visceral and cranial palpatory testing?)
Hêche, M.
Unpublished MSc thesis, 2021/04
Free full text
1711

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
1712

Predicting Osteopathic Medical Students' Performance on the United States Medical Licensing Examination From Results of the Comprehensive Osteopathic Medical Licensing Examination
Smith, T., Kauffman, M., Carmody, J. B., Gnarra, J.
Cureus, 2021/04
Free full text
1713

Principes, déterminants et processus de l’examen physique ostéopathique : une étude qualitative
(Principles, determinants and processes of the osteopathic physical examination: a qualitative study)
Pittet, E.
Unpublished MSc thesis, 2021/04
Free full text
1714

Die Phänomenologie als wissenschaftliche Grundlage der Osteopathie
(Phenomenology as the scientific basis of osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/04
1715

Evidence-based assessment of potential therapeutic effects of adjunct osteopathic medicine for multidisciplinary care of acute and convalescent COVID-19 patients
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/04
Free full text
1716

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text
1717

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04
1718

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text
1719

The effect of visceral manipulation on Diastasis Recti Abdominis (DRA): A case series
Kirk, B., Elliott-Burke, T.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
1720

Telemanagement of Home-Isolated COVID-19 Patients Using Oxygen Therapy With Noninvasive Positive Pressure Ventilation and Physical Therapy Techniques: Randomized Clinical Trial
Adly, A. S., Adly, M. S., Adly, A. S.
Journal of Medical Internet Research, 2021/04
Free full text
1721

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
1722

Direct measurement of the rhythmic motions of the human head identifies a third rhythm
Rasmussen, T. R., Meulengracht, K. C.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
1723

Evaluation of dynamic MRI data in patients with herniated intervertebral discs after the complex treatment including osteopathic correction
(Оценка данных динамического МРТ-обследования пациентов с грыжами межпозвонковых дисков на фоне комплексного лечения, включавшего остеопатическую коррекцию)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2021/04
Free full text
1724

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text
1725

Possibilities of osteopathic correction methods using in the treatment of dorsopathy at the cervicothoracic level
(Возможности применения остеопатических методов коррекции в терапии дорсопатии на шейно-грудном уровне)
Belash, V. O., Nenashkina, E. N.
Russian Osteopathic Journal, 2021/04
Free full text
1726

Perceptions of nonopioid treatment for pain in a homeless population
Fraser, K. A., Nguyen, H., Kim, S., Park, F., Bernal, J., Westberg, A. D., Podawiltz, A.
Journal of Osteopathic Medicine, 2021/04
Free full text
1727

Possibilities of correction of the statodynamic stereotype violations in patients with dorsopathy at the cervical-thoracic level
(Возможности коррекции нарушения статодинамического стереотипа у пациентов с дорсопатией на шейно-грудном уровне)
Belash, V. O., Vorobyova, A. E., Vasyukovich, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
1728

Results of the inclusion of osteopathic correction in the complex therapy of patients with chronic gastritis
(Результаты включения остеопатической коррекции в состав комплексной терапии пациентов с хроническим гастритом)
Fazlyakhmetov, R. T., Safiullin, R. R., Ustinov, A. V.
Russian Osteopathic Journal, 2021/04
Free full text
1729

Effects of the release technique by pressing on the latent myofascial trigger point of the upper trapezius muscle: random controlled clinical trial
(Эффект техники освобождения при помощи давления на латентную миофасциальную триггерную точку в верхней части трапециевидной мышцы: рандомизированное контролируемое клиническое исследование)
Ferreira Faria, M. A., Bautista Aguirre, F.
Russian Osteopathic Journal, 2021/04
Free full text
1730

The effectiveness of the osteopathic correction in the complex treatment of adult patients with gastroesophageal reflux disease
(Эффективность остеопатической коррекции в комплексном лечении взрослых пациентов с гастроэзофагеальной рефлюксной болезнью)
Naletova, T. P., Udintsev, E. P., Oreshko, A. Y., Chusovitina, O. A.
Russian Osteopathic Journal, 2021/04
Free full text
1731

Formation and development of osteopathy as a scientific discipline
(Становление и развитие остеопатии как научной дисциплины)
Novikov, Y. O., Mokhov, D. E., Tregubova, E. S.
Russian Osteopathic Journal, 2021/04
Free full text
1732

Dynamic carpal tunnel syndrome: pathophysiology, features of osteopathic diagnosis and treatment
(Динамический туннельный синдром запястного канала: патофизиология, особенности остеопатической диагностики и лечения)
Stefanidi, A. V., Balabanova, N. V.
Russian Osteopathic Journal, 2021/04
Free full text
1733

Meaningful use of COMSAE Phase 1 in preparation for COMLEX-USA Level 1
Wang, X., Maeda, H., Craig, B., Tsai, T. H., Sandella, J. M., Fleury, M.
Journal of Osteopathic Medicine, 2021/04
Free full text
1734

Results of osteopathic correction of myopia and accommodation spasm in children: systematic review using meta-analysis
(Результаты остеопатической коррекции при миопии и спазме аккомодации у детей: систематический обзор с применением метаанализа)
Vedyashkina, A. S., Milutka, Y. A., Lomakina, Y. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/04
Free full text
1735

Substantiation of the possibility of osteopathic correction inclusion in the measures complex for the preoperative preparation of patients planned for extended abdominal surgery
(Обоснование возможности включения остеопатической коррекции в комплекс мер по предоперационной подготовке пациентов, планируемых на расширенные абдоминальные операции)
Volkov, P. A., Litvinov, N. I., Bolotov, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
1736

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text
1737

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text
1738

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04
1739

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text
1740

Effektivität der Osteopathie im zentralnervösen/-neurologischen Bereich, Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manual treatments in the central nervous/ -neurological area, A Systematic review of the literature)
Pflügler, S.
Unpublished MSc thesis, 2021/04
Free full text
1741

Effektivität einer osteopathischen Behandlung der Nieren bei Leistenschmerz von Sportlern – eine einfach verblindete randomisierte Studie
(Effectiveness of an osteopathic kidney treatment for groin pain in athletes – a single blinded randomized trial)
Pakosta, M.
Unpublished MSc thesis, 2021/04
Free full text
1742

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04
1743

Der Effekt des osteopathischen Ansatzes und osteopathischer Techniken auf Symptome, insbesondere Schmerz, und Lebensqualität bei CMD – ein systematischer Review
(Efficacy of osteopathic approach and osteopathic techniques on pain, symptoms and quality of life in temporomandibular joint disorder: a systematic review)
Ixenmaier, D.
Unpublished MSc thesis, 2021/04
Free full text
1744

Auswirkungen eines auf dem Fasziendistorsionsmodell basierenden osteopathischen Interventionsprogramms auf die Hüftmobilität und subjektiv empfundene Lebensqualität von Coxarthrosepatienten im Vergleich zur physiotherapeutischen Standardbehandlung Eine randomisiert kontrollierte Studie
(A randomized controlled trial on the effects of an osteopathic treatment method according to the Fascial Distortion Model on the hip mobility and subjectively perceived quality of life of coxarthrosis patients)
Holzer-Jüttner, S.
Unpublished MSc thesis, 2021/04
1745

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
1746

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04
1747

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
1748

La collaboration entre ostéopathes et logopédistes en Suisse romande, sa qualité, ses freins, les signes et symptômes cliniques qui appellent à collaborer : une étude quantitative
(Collaboration between osteopaths and speech therapists in French-speaking Switzerland, its quality, its obstacles, the clinical signs and symptoms that call for collaboration: a quantitative study)
Dahinden, L., Sieber, L.
Unpublished MSc thesis, 2021/04
Free full text
1749

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text
1750

Osteopathic Manipulative Treatment to Optimize the Glymphatic Environment in Severe Traumatic Brain Injury Measured With Optic Nerve Sheath Diameter, Intracranial Pressure Monitoring, and Neurological Pupil Index
Kashyap, S., Brazdzionis, J., Savla, P., Berry, J. A., Farr, S., Patchana, T., Majeed, G., Ghanchi, H., Bowen, I., Wacker, M. R., Miulli, D. E.
Cureus, 2021/03
Free full text
1751

Das benigne Prostatasyndrom im Kontext der Osteopathie
(Benign prostate syndrome in the context of osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1752

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
1753

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Expert*inneninterviews – Teil 2: Qualitative empirische Daten
(The osteopathic treatment of interosseous lesions: A qualitative content analysis of experts' interviews - Part 2: Qualitative empirical data)
Stecker, D.
Osteopathische Medizin, 2021/03
1754

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1755

Osteopathische Behandlung bei Vulvodynie
(Osteopathic treatment for vulvodynia)
Morgentau, M. J., Reinartz, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1756

Randomisierte kontrollierte Studien zur osteopathischen Behandlung des Ganglion pterygopalatinum
(Randomized controlled trials for osteopathic treatment of the pterygopalatine ganglion.)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1757

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1758

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text
1759

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text
1760

Developing a psychologically-informed pain management course for use in osteopathic practice: The OsteoMAP cohort study
Abbey, H., Nanke, L., Brownhill, K.
International Journal of Osteopathic Medicine, 2021/03
1761

Patient expectations of manual and non-manual therapy within an osteopathic consultation: A cross sectional study
Tripodi, N., Garrett, A., Savic, D., Sadrani, K., Robertson, L., Volarich, S., Sirgiovanni, T.
International Journal of Osteopathic Medicine, 2021/03
1762

Moderate to Substantial Inter-Rater Reliability in the Assessment of Cranial Bone Mobility Restrictions
Demers, K., Morin, C., Collette, L., DeMont, R.
The Journal of Alternative and Complementary Medicine, 2021/03
1763

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text
1764

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text
1765

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text
1766

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03
1767

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, D., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/03
Free full text
1768

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text
1769

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03
1770

New clinical research urgently needed for adjunctive OMT treatment in elderly patients hospitalized with COVID-19 pneumonia
Vanacore, N.
Journal of Osteopathic Medicine, 2021/03
Free full text
1771

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03
1772

The Impact of the ACGME/AOA Single Accreditation System on Osteopathic Surgical Specialties, Residents, and DO Students
Cummings, M.
Journal of Surgical Education, 2021/03
1773

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text
1774

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03
1775

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03
1776

Effekt der Osteopathie auf Patientinnen mit Dysmenorrhoe - Ein Systematischer Review
(Effectiveness of Osteopathy in Patients with Dysmenorrhea - A systematic review)
Thurner, C.
Unpublished MSc thesis, 2021/03
Free full text
1777

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text
1778

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
1779

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 2: Diskussion und Implikationen für die viszerale Osteopathie
(Defense reactions from the perspective of visceral osteopathy - Part 2: Discussion and implications for visceral osteopathy)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2021/03
1780

Effect of Autonomic Nervous System Recovery from Sympathetic Challenge Using Osteopathic Cranial Manipulative Medicine – A Pilot Study
Blumer, J. U.
The AAO Journal, 2021/03
Free full text
1781

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text
1782

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
1783

Complementary and alternative medicine use by pediatric oncology patients before, during, and after treatment
Lüthi, E., Diezi, M., Danon, N., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
BMC Complementary Medicine and Therapies, 2021/03
1784

Osteopathic Cranial Manipulation and Myofascial Release of Anterior Fascia to Improve Respiratory Dynamics in Obstructive Sleep Apnea Syndrome: A Case Series
Torres, J. W.
The AAO Journal, 2021/03
Free full text
1785

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03
1786

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text
1787

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03
1788

A blame game and sticky labels: A qualitative study of osteopaths’ experiences of managing patients with pain catastrophising
Pelekanou, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/03
1789

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text
1790

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
1791

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text
1792

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text
1793

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text
1794

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
1795

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
1796

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1797

A mixed treatment comparison of selected osteopathic techniques used to treat acute nonspecific low back pain: a proof of concept and plan for further research
Price, J. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
1798

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1799

Auswirkung einer Behandlung des lateralen Triggerbandes des Oberschenkels nach Prinzipien des Fasziendistorsionsmodells auf die Hüftbeweglichkeit
(Effect of a treatment of the lateral trigger band of the thigh according to the principles of the fascia distortion model by Dr. Stephen Typaldos on hip mobility)
Schulz, K.
Unpublished MSc thesis, 2021/02
Free full text
1800

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text
1801

Mindfulness: Principles and Application to Decrease Opiate Use in Primary Care With an Osteopathic Component
Frasca, D. J.
Osteopathic Family Physician, 2021/02
Free full text
1802

Effektivität der Osteopathischen Behandlung auf den Blutdruck - Eine Literaturübersichtsarbeit
(The effectiveness of the osteopathic treatment on blood pressure - A systematic review)
Vorreiter, A.
Unpublished MSc thesis, 2021/02
Free full text
1803

Osteopathische Behandlung bei Erwachsenen mit Zerebralparese - Wirkung eines osteopathischen Behandlungsprotokolls im Vergleich zur Vojta-Therapie auf Lungenfunktionsstörungen bei Erwachsenen mit Zerebralparese
(Osteopathic treatment of adults with cerebral palsy – Effects of an osteopathic treatment protocol compared with Vojta-therapy on impaired lung function in adults with cerebral palsy)
Walter, U.
Unpublished MSc thesis, 2021/02
1804

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02
1805

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
1806

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02
1807

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text
1808

Einfluss der Osteopathie auf das Hormon Cortisol
(The Effects of an Osteopathic Treatment on Cortisol Levels)
Lederbauer, C.
Unpublished MSc thesis, 2021/02
Free full text
1809

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02
1810

Die osteopathische Anwendung der CV4 Technik bei Patientinnen und Patienten mit chemoinduzierter Polyneuropathie nach zytostatischer Chemotherapie
(The Osteopathic Application of the CV4 Technique in Patients with Chemotherapy-induced Polyneuropathy after Cytostatic Chemotherapy)
Flaschberger, P.
Unpublished MSc thesis, 2021/02
Free full text
1811

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text
1812

Einfluss einer osteopathischen Behandlung auf chemotherapeutisch induzierte Nausea und Vomiting (CINV) und auf die gesundheitsbezogene Lebensqualität während emetogen wirkender Chemotherapie
(The Influence of Osteopathic Treatment on Chemotherapy Induced Nausea and Vomiting (CINV) and Health Related Quality of Life (QoL) in Patients with Cancer treated with Emetogenic Chemotherapy)
Aranya-Mayr, J.
Unpublished MSc thesis, 2021/02
1813

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Spanish osteopaths
Alvarez, G., Justribo, C., Sundberg, T., Thomson, O. P., Leach, M. J.
BMC Health Services Research, 2021/02
Free full text
1814

Osteopathic neuromuscular rehabilitation: A novel approach to treat spasticity following systemic illness, brain tumour, and traumatic brain injury in general population
Ali, I.
Unpublished PhD thesis, 2021/02
Free full text
1815

Forschung in der Osteopathie. Eine qualitative, phänomenologische und systematische Studie.
(Research in Osteopathy. A qualitative, phenomenological and systematic study.)
Stecker, D.
unpublished MSc thesis, 2021/02
Free full text
1816

Osteopathische Behandlung bei Plagiozephalie
(Osteopathic treatment of plagiocephaly)
Kenner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1817

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1818

Die Osteopathie aus Sicht der Allgemeinmediziner – eine qualitative Interviewstudie
(Osteopathy from the point of view of general practitioners - a qualitative interview study)
Waubert de Puiseau, A., Hörcher, M., Belz, S., Esch, S.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1819

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1820

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1821

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text
1822

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1823

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1824

Impact of an osteopathic presence in a large categorical pediatric residency training program
Barnhardt, E. W., Comer, F., Zmuda, E., Rakowsky, A.
Journal of Osteopathic Medicine, 2021/01
Free full text
1825

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01
1826

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
1827

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
1828

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text
1829

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text
1830

Journal of Osteopathic Medicine: a refreshed and refocused publication for our profession
Zafonte, R. D.
Journal of Osteopathic Medicine, 2021/01
Free full text
1831

Investigating the current literature comprising osteopathic manual therapy (OMT) as an intervention: A scoping review
Ryan, H.
Unpublished MSc thesis, 2021/01
Free full text
1832

Effects of Craniosacral Osteopathy in Patients with Peripheral Vestibular Pathology
Atay, F., Bayramlar, K., Sarac, E. T.
ORL - Journal for Oto-Rhino-Laryngology and its Related Specialties, 2021/01
1833

A Class By Themselves: Texas' Newest Med Schools Adjust to COVID-19
Price, S.
Texas Medicine, 2021/01
1834

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text
1835

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text
1836

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text
1837

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
1838

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text
1839

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
1840

Inanspruchnahme osteopathischer Medizin bei chronisch und Langzeit-Erkrankten
(Use of osteopathic medicine for chronic and long-term patients)
Beer, A.M., Kiseier, P., Weber, H.
Journal für Pharmakologie und Therapie, 2021
Free full text
1841

Veränderungen des Visus durch Therapie der Synchondrosis sphenooccipitalis an Kurzsichtigen - eine doppelblindierte Studie
(Changes in visual acuity due to therapy of sphenooccipital synchondrosis in myopic patients - a double-blind study)
Angerer, S.
Unpublished MSc thesis, 2020/12
Free full text
1842

The short-form Orebro Musculoskeletal Pain Questionnaire (OMPQ-10): Associations with determinants of health and demographics in a musculoskeletal pain cohort
Vaughan, B., Fitzgerald, K., Flesichmann, M., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/12
1843

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1844

Das osteopathische Labor: Erfahrung ermöglichen
(The osteopathic laboratory: Enabling experience)
Levin, P., Strebel, W.
Osteopathische Medizin, 2020/12
1845

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text
1846

Professionnalisation des formateurs en ostéopathie à travers l'analyse de leur activité
(Professionalization of osteopathic teachers through analysis of their activity)
Garnier, F.
Unpublished PhD thesis, 2020/12
Free full text
1847

La prise en charge des grands syndromes cranio-maxillo-faciaux en ostéopathie pédiatrique : Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy
(Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy)
Lalauze-Pol, R.
Unpublished PhD thesis, 2020/12
1848

Knowledge of Nutritional Issues among Osteopaths in Austria: A Cross-Sectional Study
Putschögl, J., Woisetschläger, G.
European Journal of Osteopathic Research, 2020/12
Free full text
1849

The influence of an osteopathic treatment on pregnant women on expected date of delivery on the course of parturition and the subjective well-being: A Pilot Study
Tauch, A.
European Journal of Osteopathic Research, 2020/12
Free full text
1850

Psychosomatische Osteopathie bei Trauma am Beispiel der bifokalen Integration
(Psychosomatic osteopathy in trauma using the example of bifocal integration)
Liem, T., Neuhuber, W.
Osteopathische Medizin, 2020/12
1851

Characteristics and Management of Pregnant Patients From a Neuromusculoskeletal Medicine/Osteopathic Manipulative Medicine Clinic
Frank, L. D., Bhatia, S., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1852

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1853

CRI over MRI: A Cranial Approach to Dizziness
Qureshi, Y., Patel, U., Mercer, A.
The AAO Journal, 2020/12
Free full text
1854

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1855

Osteopatia in Italia. Passato, presente e prospettive future: parte I
(Osteopathy in Italy. Past, present and future perspectives. Part 1)
Civitillo, C., Marasco, M. L., D&rsquo, Onofrio, R.
GIOSBE Journal, 2020/12
Free full text
1856

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
1857

Der Milchglasblick oder das Lächeln der Mona Lisa
(The frosted glass look or the smile of Mona Lisa)
Sibbing, D.
Osteopathische Medizin, 2020/12
1858

20 Jahre „Osteopathische Medizin”: Ein Blick in die Vergangenheit und in die Zukunft
(20 years of “Osteopathische Medizin“: A look into the past and into the future)
Tempelhof, Siegbert
Osteopathische Medizin, 2020/12
1859

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1860

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12
1861

Upper airway stabilization by osteopathic manipulation of the sphenopalatine ganglion versus sham manipulation in OSAS patients: a proof-of-concept, randomized, crossover, double-blind, controlled study
Jacq, O., Arnulf, I., Similowski, T., Attali, V.
BMC Complementary and Alternative Medicine, 2020/12
Free full text
1862

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1863

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text
1864

Results of complex treatment with the inclusion of osteopathic correction of somatic dysfunctions in perinatal CNS lesions in children of the first year of life
(Результаты комплексного лечения с включением остеопатической коррекции соматических дисфункций при перинатальном поражении ЦНС у детей первого года жизни)
Abramova, E. V., Aptekar, I. A., Aptekar, V. I., Yudina, A. A.
Russian Osteopathic Journal, 2020/12
Free full text
1865

Comparative study of the effectiveness of standard therapy and the complex therapy with inclusion of osteopathic correction, in patients with discogenic SI radiculopathy
(Сравнительное исследование эффективности стандартной и комплексной, включающей остеопатическую коррекцию, терапии пациентов с дискогенной SI радикулопатией)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2020/12
Free full text
1866

Reflexology in the treatment of patients with dorsopathy
(Рефлексотерапия в лечении пациентов с дорсопатией)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
1867

Osteopathic correction in the complex therapy of patients with hemispasm
(Остеопатическая коррекция в комплексной терапии пациентов с гемиспазмом)
Belash, V. O., Guzhina, E. Y.
Russian Osteopathic Journal, 2020/12
Free full text
1868

Cranial Manipulation Affects Neuronal Gene Expression, Explaining the Improved Cognitive Ability in an Animal Model of Age-related Cognitive Decline
Anandakrishnan, R.
The Journal of the American Osteopathic Association, 2020/12
1869

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12
1870

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12
1871

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text
1872

The Effect of Osteopathic Manipulative Treatment on Stiff Person Syndrome
Bazzi, M. O., Vemuri, A., Downing, M. A., Barry, P. E.
The Journal of the American Osteopathic Association, 2020/12
1873

Hand Model Utility for Osteopathic Pelvic Diagnosis in a Remote Learning Setting
Burg, B. J., Ketigian, L. A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/12
1874

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12
1875

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12
1876

The Use of Osteopathic Manipulation to Facilitate Bone Remodeling in a Postmenopausal Osteoporotic Woman
Grabie, Y., Jamil, N., Habib, N., Simone, J. J.
The Journal of the American Osteopathic Association, 2020/12
1877

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12
1878

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12
1879

The Effects of Osteopathic Manipulative Treatment on HbA1c in Type 2 Diabetes and Pre-diabetes: A Randomized-Control Clinical Trial
Sureshbabu, S., Sheflin, K., Li, T. S., Heller, M., Yusupov, E., Krishnamachari, B., Allera, A., Rivera-Martinez, S.
The Journal of the American Osteopathic Association, 2020/12
1880

2020 AOA Research Abstracts and Poster Competition
listed, No authors
The Journal of the American Osteopathic Association, 2020/12
Free full text
1881

Comparison of the effects of a Mitchell’s myotensive technique and the strain-shortening technique on passive axial rotation of the cervical spine
(Сравнение влияния миотензивной техники Митчелла и так называемой техники укорочения с сопротивлением на пассивную осевую ротацию шейного отдела позвоночника)
Dehiles, R., Salem, W., Klein, P.
Russian Osteopathic Journal, 2020/12
Free full text
1882

Utilizing Osteopathic Manipulative Treatment as a Non-Surgical Approach to Severs Disease in a Growing Adolescent
Madhu, B., Goldenhart, A.
Southern Medical Journal, 2020/12
1883

Comparison of manual therapy and pharmacotherapy effectiveness in the treatment and rehabilitation of patients with piriformis syndrome
(Сравнение эффективности мануальной терапии и фармакотерапии в лечении и реабилитации пациентов с синдромом грушевидной мышцы)
Frolov, V. A., Akopyan, M. S., Berezin, V. V.
Russian Osteopathic Journal, 2020/12
Free full text
1884

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
1885

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
1886

Osteopathic status of preterm infants with intraventricular hemorrhage
(Особенности остеопатического статуса у недоношенных детей с внутрижелудочковым кровоизлиянием)
Karimova, L. K., Kuzmina, J. O., Zinnurova, Z. N., Vasilevskaja, E. M.
Russian Osteopathic Journal, 2020/12
Free full text
1887

The influence of osteopathic correction to the level of stress in patients with cervicobrachialgia
(Влияние остеопатической коррекции на уровень стресса у пациенток с цервикокраниалгией)
Korman, D. V., Yushmanov, I. G.
Russian Osteopathic Journal, 2020/12
Free full text
1888

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12
1889

Osteopathic correction as part of the complex treatment of primary biliary cholangitis
(Остеопатическая коррекция в составе комплексного лечения первичного билиарного холангита)
Lebedev, D. S., Nizamova, A. H.
Russian Osteopathic Journal, 2020/12
Free full text
1890

Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction
(Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
1891

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1892

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
1893

Einzelfallstudie über den Einfluss einer osteopathischen Behandlung eines Mannes mit unerfülltem Kinderwunsch
(Single Case Study on the Influence of an Osteopathic Treatment of One Man with the Unfulfilled Desire To Have a Child)
Mayrhofer, M.
Unpublished MSc thesis, 2020/12
Free full text
1894

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1895

An Osteopathic Modular Approach to Asthma: A Narrative Review
Schend, J., Rowane, M., Sanan, N., Hostoffer, S. R.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1896

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1897

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11
1898

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1899

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11
1900

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
1901

Osteopathische Anwendung bei Aufmrksamkeits - Defizit - Syndrom
(Osteopathic application in case of lack of concentration)
Werth, B.
Unpublished MSc thesis, 2020/11
1902

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text
1903

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
1904

Osteopathic Approach to Treatment of Carpal Dysfunction: The Carpal Mobilization Technique
Mehner, T. R., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1905

Die Sicherheit von Osteopathie bei Schwangeren anhand der Auswirkung auf das mögliche Risiko von Komplikationen vor, während und nach der Geburt
(The safety of osteopathy in pregnant women based on its impact on the risk of complications before, during, and after childbirth)
Kleindessner, A.
Unpublished MSc thesis, 2020/11
Free full text
1906

Auswirkungen des CV4 bei PflegerInnen in der stationären Altenpflege, gemessen anhand der psychischen Belastung und Beanspruchung
(Effects of CV4 on nurses in elderly residential care, measured on the basis of mental workload and strain)
Falkensteiner, S.
Unpublished MSc thesis, 2020/11
Free full text
1907

Chronisch-funktionelle Obstipation bei Kindern – Eine fallkontrollierte Studie Ist Osteopathie effektiver als die medizinische Standardbehandlung?
(Functional Constipation in Childhood – A Case Controlled Study Is osteopathic treatment more effective than medicinal standard treatment?)
Eisenschenk, R.
Unpublished MSc thesis, 2020/11
Free full text
1908

Einfluss einer osteopathischen Behandlung der Halswirbelsäule bei Schulterschmerzen
(Influence of an osteopathic treatment on shoulder pain)
Albrecht, J. M.
Unpublished MSc thesis, 2020/10
Free full text
1909

Situation, Chancen und Herausforderungen der Osteopathie in der Schweiz
(Characteristics, Opportunities and Challenges of Osteopathy in Switzerland)
Meier, M. D., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1910

Evaluating the quality of clinical teaching in osteopathy
Vaughan, B.
Unpublished PhD thesis, 2020/10
Free full text
1911

Osteopathic Manipulative Treatment in Individuals With Vertigo and Somatic Dysfunction: A Randomized, Controlled, Comparative Feasibility Study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1912

Anwendung des Viszeroletic-Konzeptes beim Reizdarmsyndrom
(Applying the Visceroletic-Concept to the Irritable Bowel Syndrome)
Ryback, S.
Unpublished MSc thesis, 2020/10
Free full text
1913

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
1914

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10
1915

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text
1916

Clinical characteristics of osteopaths treating work-related injuries in Australia: a cross-sectional study
Adams, J., Peng, W., Steel, A., Vaughan, B., Fleischmann, M., Fitzgerald, K., Sibbritt, D.
International Journal of Osteopathic Medicine, 2020/10
1917

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text
1918

Effektivität von Osteopathie bei Patient/en/innen mit gastrointestinalen Erkrankungen; Eine systematische Übersichtsarbeit
(Effectiveness of Osteopathy in Patients with Gastrointestinal Diseases - A Systematic Review)
Schönberger, B.
Unpublished MSc thesis, 2020/10
Free full text
1919

Communication Skills of Grandview/Southview Medical Center General Surgery Residents
Johnson, W., Ngo, A., Elrod, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1920

Osteopathic Medical Licensing Compliance With the Americans With Disabilities Act of 1990
Lincoln, K. A., Wagner, B. E.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1921

Attitudes, skills, and use of evidence-based practice: a cross-sectional survey of Swedish osteopaths
Leach, M. J., Shaw, R., Austin, P., Fryer, G., Thomson, O. P., Adams, J., Skillgate, E., Sundberg, T.
International Journal of Osteopathic Medicine, 2020/10
1922

Osteopathie bei PatientInnen mit Knochenmarködemen im Kniegelenksbereich - Eine nicht kontrollierte Interventionsstudie
(Osteopathy related to patients with bone marrow edema – A non-controlled intervention study)
Taferner, W.
Unpublished MSc thesis, 2020/10
Free full text
1923

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10
1924

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1925

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text
1926

A Case of Resolved Vincristine-Induced Constipation Following Osteopathic Medicine in a Patient With Infantile Fibrosarcoma
Belsky, J. A., Wolf, K., Setty, B. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1927

Osteopathic Manipulative Treatment for a Recognizable Pattern of Somatic Dysfunction Following Laparoscopic Cholecystectomy
Mills, M., Sevensma, K., Serrano, J.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1928

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text
1929

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text
1930

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text
1931

Osteopathie in Norwegen
(Osteopathy in Norway)
Becher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1932

Im Gespräch mit … Diana Stöckl
(In dialog with … Diana Stöckl)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1933

Osteopathie bei umschriebenen Entwicklungsstörungen
(Osteopathy for specific developmental disorder)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1934

“I do it my way” - Italian osteopaths’ beliefs and attitudes about five osteopathic models: A qualitative study
Bettelli, L., Pisa, V., Formica, A.
International Journal of Osteopathic Medicine, 2020/10
1935

Auswirkungen von osteopathischen Behandlungen im Vergleich zur Anwendung eines Entspannungsverfahrens auf die Lebensqualität von Endometriose-Patientinnen
(Effects of Osteopathic Treatments in Comparison to a Relaxation-Method on the Quality of Life of Endometriosis Patients)
Kremen-Pilz, I.
Unpublished MSc thesis, 2020/10
Free full text
1936

Osteopathie bei epileptischen Anfällen
(Osteopathy for epileptic disorder)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1937

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht Teil 2: Was wirkt im Wirk-Bündnis der Osteopathie?
(Who and what constitutes connection within osteopathic treatment? A medical-philosophical contribution from the osteopathic point of view. Part 2: What works in the active alliance of osteopathy?)
Kaiser, A. K.
Osteopathische Medizin, 2020/09
1938

Die kranio-kaudale Bewegung im Articulatio tibiofibulare proximalis bei einer Dorsalextension und Plantarflexion im Articulatio talocruralis
(The cranial and caudal movement of the Art. Tibiofibularis proximalis during dorsalextension and plantarflexion)
Bernhardt, M.
Unpublished MSc thesis, 2020/09
Free full text
1939

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text
1940

Continuing debates about models of practice
Vogel, S.
International Journal of Osteopathic Medicine, 2020/09
1941

The Immediate, Intermediate, and Long-Term Effects of Osteopathic Manipulative Treatment on Pulmonary Function in Adults with Asthma
Kasten, K. M., Tyler, S. K., Johnson, A. R., Kolakowski, E. R., Pickos, J., Heineman, K., Jie, C.
The AAO Journal, 2020/09
Free full text
1942

Osteopathische Behandlung des Larynx
(Osteopathic treatment of the larynx)
Liem, T.
Osteopathische Medizin, 2020/09
1943

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09
1944

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text
1945

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Experteninterviews – Teil 1: Theorie und Forschungsstand
(The osteopathic treatment of interosseous lesions. A qualitative content analysis of experts' opinion - Part 1: Theory and state of research)
Stecker, D.
Osteopathische Medizin, 2020/09
1946

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 2: Klinische Bedeutung für die muskuloskelettale Behandlung (German translation)
(Extension of the biopsychosocial model for musculoskeletal practice. Part 2: Clinical significance for musculoskeletal treatment)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/09
1947

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text
1948

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09
1949

EEG-Fokus: osteopathisch-manualmedizinische Therapie?
Paul, Heike, Heller, Rainer
Manuelle Medizin, 2020/09
1950

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09
1951

The rationale for the combined use of osteopathic methods of correction and reflexology in the complex treatment of patients with dorsopathy at the cervico-thoracic level
(Обоснование сочетанного применения остеопатических методов коррекции и рефлексотерапии в комплексной терапии пациентов с дорсопатией на шейно-грудном уровне)
Belash, V. O., Urazgalieva, L. R., Fayzullina, R. I., Agasarov, L. G.
Russian Osteopathic Journal, 2020/09
Free full text
1952

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in women: a pilot study
Taylor, V. J.
Unpublished MSc thesis, 2020/09
Free full text
1953

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in men: a pilot study
Rahier, A.
Unpublished MSc thesis, 2020/09
Free full text
1954

“Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research”
Lunghi, C., Liem, T.
International Journal of Osteopathic Medicine, 2020/09
1955

Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review
(Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
1956

The structure of somatic dysfunctions in women with a nodular form of uterine myoma
(Структура соматических дисфункций у женщин с узловой формой миомы матки)
Chebotaeva, G. N., Lebedev, D. S.
Russian Osteopathic Journal, 2020/09
Free full text
1957

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
1958

Effects of a General Osteopathic treatment on asthmatic children
(Влияние общего остеопатического лечения на функцию внешнего дыхания детей, страдающих астмой)
Ernoult, B., Job, H.
Russian Osteopathic Journal, 2020/09
Free full text
1959

Rationale for the use of osteopathic correction methods in patients with Sudeck syndrome
(Обоснование применения методов остеопатической коррекции у пациентов с синдромом Зудека)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/09
Free full text
1960

Possibilities of applying of osteopathic correction methods in the treatment of pain syndrome in nephroptosis
(Возможности применения остеопатических методов коррекции в лечении болевого синдрома при нефроптозе)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/09
Free full text
1961

Etiopathogenetic aspects of somatic dysfunction formation during pregnancy
(Этиопатогенетические аспекты формирования соматических дисфункций во время беременности)
Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2020/09
Free full text
1962

The application of physical therapy and balneology of the patients with non-specific low back pain (literature review
(Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
1963

The osteopathic status specific of the practically healthy group of the military age male population
(Особенности остеопатического статуса у практически здоровой группы мужского населения призывного возраста)
Petrova, G. V., Pushkarev, I. M., Savel′yeva, N. V., Solovey, N. L., Shiryayeva, E. E., Yanushanets, O. I.
Russian Osteopathic Journal, 2020/09
Free full text
1964

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09
1965

Response to: Models and theoretical frameworks for osteopathic care - A critical view and call for updates and research
Santiago, R., Campos, B., Moita, J., Nunes, A. C. L.
International Journal of Osteopathic Medicine, 2020/09
1966

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09
1967

What do UK osteopaths view as the safest lifting posture, and how are these views influenced by their back pain beliefs?
Smith, K., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/09
1968

Übersicht der osteopathischen Studien 2019: Der INIOST Studienreport 2019
(Overview of the osteopathic studies in 2019: The INIOST Study Report 2019)
Franke, H.
Osteopathische Medizin, 2020/09
1969

Die Brustdrüse aus osteopathischer Sicht: Teil 1: Grundlagen
(The mammary gland from an osteopathic point of view. Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2020/09
1970

Biomedical origins of the term 'osteopathic lesion' and its impact on people in pain
Noy, M., Macedo, L., Carlesso, L.
International Journal of Osteopathic Medicine, 2020/09
1971

The development and exploratory analysis of the Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ)
Thomson, O. P., Anstiss, V.
International Journal of Osteopathic Medicine, 2020/09
1972

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1973

Utilizing Health Professional Students’ Knowledge, Attitudes, and Beliefs to Inform the Development of a Contact-Based Educational Approach to Address the Opioid Epidemic
Mort, S. C.
Unpublished PhD thesis, 2020/08
Free full text
1974

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text
1975

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1976

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1977

Osteopathic Manipulative Treatment for Inhaled Rib Somatic Dysfunction
Koch, J., Tsui, C., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1978

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1979

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1980

Osteopathic Medicine and the Osteoporosis Management Gap
Lowery, J. W., Baker, J., Gebhardt, G. P., Gorbis, S., Hoehn, A., Hum, J. M., Nelligan, L., Sefcik, D., Wacker, B., Wagner, A., Williams, D., Wright, A.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1981

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text
1982

Telemedicine During a Pandemic with Osteopathic Considerations
Rhoads, A.
Osteopathic Family Physician, 2020/08
Free full text
1983

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1984

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1985

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1986

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text
1987

Positional plagiocephaly from structure to function: Clinical experience of the service of pediatric osteopathy in Italy
Filisetti, M., Cattarelli, D., Bonomi, S.
Early Human Development, 2020/07
1988

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
1989

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1990

Perspectives on tissue adaptation related to allostatic load: scoping review and integrative hypothesis with a focus on osteopathic palpation
Lunghi, C., Consorti, G., Tramontano, M., Esteves, J. E., Cerritelli, F.
Journal of Bodywork and Movement Therapies, 2020/07
1991

Vestibular failure managed with osteopathic manipulative treatment: A report of two cases
Origo, D., Tarantino, A. G., Romagnoli, M.
Journal of Bodywork and Movement Therapies, 2020/07
1992

Osteopathic Treatment leads to significantly greater reductions in chronic thoracic pain after CABG surgery: a randomised controlled trial
Roncada, Gert
Journal of Bodywork and Movement Therapies, 2020/07
1993

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07
1994

Services and staffing practices in academic health sciences libraries serving college of osteopathic medicine programs: a mixed methods study
Muellenbach, J. M., Duncan, W. C., Vanier, C., Ennis, L. A., Yang, A.
Journal of the Medical Library Association, 2020/07
Free full text
1995

Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Cicchitti, L., Di Lelio, A., Barlafante, G., Cozzolino, V., Di Valerio, S., Fusilli, P., Lucisano, G., Renzetti, C., Verzella, M., Rossi, M. C.
Medical sciences, 2020/07
Free full text
1996

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text
1997

Auswirkungen osteopathischer Techniken an der Pleura parietalis auf das Atemvolumen: Eine Pilotstudie mit gesunden Erwachsenen
(Effects of osteopathic techniques applied to the Pleura parietalis on the respiratory volume: a pilot study with healthy adults)
Strnad, V.
Unpublished MSc thesis, 2020/07
Free full text
1998

Osteopathic Response to the COVID-19 Pandemic
Martinez, E., Redding, D.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1999

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text
2000

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht, Teil 1: Was ist ein Osteopath?
(Who and what work in the effective therapeutic alliance of osteopathy? - A medical-philosophical contribution from the point of view of osteopathy. Part 1: What is an osteopath?)
Kaiser, A. K.
Osteopathische Medizin, 2020/06
2001

Regulationsstörung bei Säuglingen: neue An- und Aussichten
(Regulation disorder in infants: new approaches and prospects)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
2002

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
2003

Die visuelle Vorstellung in der osteopathischen Palpation
(Visual Imagination in Osteopathic Palpation)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
2004

Self-management behaviour and knowledge of patients with musculoskeletal complaints attending an Australian osteopathy clinic: A consecutive sampling design
Vaughan, B., Grant, M., Moroz, J., Ngawaka, C., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/06
2005

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text
2006

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
2007

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
2008

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
2009

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06
2010

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2011

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
2012

Choosing Primary Care: Factors Influencing Graduating Osteopathic Medical Students
Stefani, K. M., Richards, J. R., Newman, J., Poole, K. G., Scott, S. C., Scheckel, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2013

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2014

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06
2015

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text
2016

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06
2017

Professional identity in the evolution of osteopathic models: Response to Esteves et al
Alvarez, G., Van Biesen, T., Roura, S.
International Journal of Osteopathic Medicine, 2020/06
2018

Kleine Geburten – und wie wir sie begleiten können
(Miscarriages - and how we can attend to them)
Wikus, P., Ossberger, C.
Osteopathische Medizin, 2020/06
2019

Chiropractic and osteopathic students' perceptions of readiness for transition to practice: The educational value of university clinic vs community and private clinics
Haworth, N. G., Horstmanshof, L., Moore, K. M.
The Journal of Chiropractic Education, 2020/06
Free full text
2020

Skoliose und Osteopathie: Teil 2: Osteopathische Behandlung
(Scoliosis and osteopathy. Part 2: Osteopathic treatment)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/06
2021

The Spanish Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross-sectional survey
Alvarez, G., Roura, S., Cerritelli, F., Esteves, J. E., Verbeeck, J., van Dun, P. L. S.
PLoS ONE, 2020/06
Free full text
2022

Osteopathic medicine: A judicial section for one specific profession
Beaume, S.
Medecine et Droit, 2020/06
2023

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06
2024

Use of manual therapy applied to the viscera: Secondary analysis of a nationally representative sample of Australian osteopaths
Fleischmann, M., Vaughan, B., Fitzgerald, K., Grace, S.
International Journal of Osteopathic Medicine, 2020/06
2025

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text
2026

Influence of osteopathic correction on sports achievements of racing athletes
(Влияние остеопатической коррекции на спортивные достижения спортсменов-автогонщиков)
Azarenkova, A. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
2027

The Role of Sphenobasilar Synchondrosis in Disease and Health
Liem, T.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2028

Global osteopathic treatment in the therapy of patients with chronic tension headache
(Общее остеопатическое лечение в терапии пациентов с хронической головной болью напряжения)
Belash, V. O., Bruk, I. I.
Russian Osteopathic Journal, 2020/06
Free full text
2029

Osteopathic correction in the treatment of pain in the lower back
(Остеопатическая коррекция при лечении боли в нижней части спины)
Belash, V. O., Novikov, Y. O.
Russian Osteopathic Journal, 2020/06
Free full text
2030

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text
2031

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06
2032

Influence of osteopathic correction on the functional state of the athletes′ organism during the training process of martial arts practicing (Kendo
(Влияние остеопатической коррекции на функциональное состояние спортсменов при занятиях восточными единоборствами (кендо)
Fasikov, R. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
2033

A subjective and objective analysis of the immediate effect of osteopathic manual treatment OMT on the golf swing
Maass, Z, Buffington, A, Miner, M, Hall, M
Clinical journal of sport medicine, 2020/06
2034

Practice Locations of Michigan Ophthalmologists as a Model to Compare Practice Patterns of DO and MD Surgical Subspecialists
Ahmed, H., Price, M. J., Robbins, W., Braich, P. S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2035

Influence of Research on Osteopathic Medical Student Residency Match Success
Lowery, J. W., Hum, J. M., Obeime, I., Zahl, S., Parr, C. P., Larsen, B., King, T., Kisby, G.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2036

Possibility of osteopathic correction in the complex therapy of patients after sternotomy performed in connection with the surgical treatment of acquired heart defects
(Возможность применения остеопатической коррекции в комплексной терапии пациентов после стернотомии, выполненной в связи с хирургическим лечением приобретенного порока сердца)
Glushkov, A. A., Salakhov, R. G., Yunusova, A. D., Lebedev, D. A.
Russian Osteopathic Journal, 2020/06
Free full text
2037

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität bei einem Patienten mit einem idiopathischen zentralen Diabetes insipidus
(Potential success of an individualised osteopathic therapy for the quality of life of a patient suffering from an idiopathic central diabetes insipidus)
Zenner, C.
Unpublished MSc thesis, 2020/06
Free full text
2038

The rationale for the joint use of osteopathic correction and kinesiotherapy in the humeroscapular periarthrosis syndrome (humeroscapular periarthropathy) treatment
(Обоснование совместного применения остеопатической коррекции и метода кинезиотейпирования при лечении синдрома плечелопаточного периартроза (плечелопаточной периартропатии)
Lebedev, E. B., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
2039

Influence of osteopathic correction on the psychoemotional state and quality of life of pregnant women with concomitant pathology of the urinary system
(Влияние остеопатической коррекции на психоэмоциональное состояние и качество жизни беременных с сопутствующей патологией мочевыводящей системы)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/06
Free full text
2040

The study of the osteopathic diagnostics results′ coincidence frequency
(Исследование частоты совпадений результатов остеопатической диагностики)
Potekhina, Y. P., Milutka, Y. A., Tregubova, E. S., Yanushanets, O. I.
Russian Osteopathic Journal, 2020/06
Free full text
2041

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 2
Bordoni, B.
Cureus, 2020/06
Free full text
2042

Rationale for the use of osteopathic correction in the treatment of patients with chronic lower limb vein disease
(Обоснование применения остеопатической коррекции при лечении пациенток с хроническим заболеванием вен нижних конечностей)
Shmeleva, A. S., Mizonova, I. B.
Russian Osteopathic Journal, 2020/06
Free full text
2043

Effects of Osteopathic Care on patients suffering with pudendal neuralgia: a prospective monocentric study
(Моноцентровое проспективное исследование влияния остеопатического лечения на здоровье пациентов, страдающих невралгией полового нерва)
Tessier, A., Morin, M.P.
Russian Osteopathic Journal, 2020/06
Free full text
2044

The use of osteopathic correction in conjunction with radon baths at the sanatorium-resort stage of rehabilitation of patients with dorsopathy
(Применение остеопатической коррекции совместно с радоновыми ваннами на санаторно-курортном этапе реабилитации пациентов с дорсопатией)
Ul′ikhina, N. V., Shiryayeva, E. E.
Russian Osteopathic Journal, 2020/06
Free full text
2045

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2046

Person-centred care and traditional philosophies in the evolution of osteopathic models and theoretical frameworks: Response to Esteves et al
Steel, A., Foley, H., Redmond, R.
International Journal of Osteopathic Medicine, 2020/06
2047

Manualtherapeutische Behandlung des Zwerchfells bei Asthma bronchiale: Studien geben Hoffnung
(Manual therapy treatment of the diaphragm in bronchial asthma: studies give hope)
Funke, P., Grasmück, J., Merkt, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
2048

Beliefs about chronic low back pain amongst osteopaths registered in Spain: A cross-sectional survey
Van Biesen, T., Alvarez, G.
International Journal of Osteopathic Medicine, 2020/06
2049

Behandlung einer stauungsbedingten Trigeminusneuralgie
(Treatment of trigeminal neuralgia as a result of congestion)
Hartmann, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
2050

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
2051

Weekly Osteopathic Manipulative Treatment to Improve Measures of Sympathetic Tone in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Pilot Study
Davis, S. E., Hendryx, J., Menezes, C., Bouwer, S., Menezes, H., Patel, V., Bostick Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/05
Free full text
2052

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text
2053

Double Jeopardy: The USMLE for Osteopathic Medical Students
Ahmed, H., Carmody, J. B.
Academic Medicine, 2020/05
Free full text
2054

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text
2055

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text
2056

Osteopathie auf dem Prüfstand
[Osteopathy under scrutiny]
Dräger, K., Heller, R.
Bundesgesundheitsblatt Gesundheitsforschung Gesundheitsschutz, 2020/05
2057

Doctors Wanted: Women Encouraged to Apply. A Historical Analysis of Women in Osteopathic Medical Education
Karacay, K. C.
Unpublished PhD thesis, 2020/05
2058

Revisión sistemática del tratamiento de la fibromialgia con osteopatía
(Systematic review of the treatment of fibromyalgia with osteopathy)
Giraldo Cardona, S.
Unpublished MSc thesis, 2020/05
Free full text
2059

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05
2060

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05
2061

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 1
Bordoni, B.
Cureus, 2020/05
Free full text
2062

Visceral Mobilization and Functional Constipation in Stroke Survivors: A Randomized, Controlled, Double-Blind, Clinical Trial
Pasin Neto, H., Borges, R. A.
Cureus, 2020/05
Free full text
2063

Eine deskriptive Studie der osteopathischen Praxistätigkeit der Schweizer Ärztegesellschaft für Osteopathische Medizin
(A descriptive study of osteopathic practice activity by the Swiss Medical Association for Osteopathic Medicine)
Good, L.
Unpublished MSc thesis, 2020/04
Free full text
2064

Obstacles rencontres et stratégies mises en place a l'obtention du consentement éclaire du patient à la manipulation structurelle dans une consultation ostéopathique : projet de recherche
(Obstacles encountered and strategies implemented to obtain the patient's informed consent to structural manipulation in an osteopathic consultation: a research project)
Grandjean-Perrenoud-Contesse, C.
Unpublished MSc thesis, 2020/04
Free full text
2065

Osteopathische Intervention bei Mydriasis nach Contusio bulbi
(Osteopathic Intervention for Mydriasis after Contusio bulbi)
Lehnen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
2066

Der Subarachnoidalraum – ein Zwischenraum mit unterschätzter Bedeutung
(The subarachnoid space - an interspace with underestimated importance)
Muntinga, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
2067

Deutschschweizer Osteopath*innen und das Verschreiben von Übungen und Ratschlägen zu physischer Aktivität
(Swiss-German osteopaths and the prescription of exercises and advice on physical activity)
Jäger, G. I.
Unpublished MSc thesis, 2020/04
Free full text
2068

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
2069

Wie erleben Cancer Survivors eine osteopathische Behandlung und wie hat diese zum allgemeinen Wohlbefinden (well-being) beigetragen? : eine qualitative Studie
(How do cancer survivors experience osteopathic treatment and how has it contributed to their overall well-being? : a qualitative study)
Meuwly, N.
Unpublished MSc thesis, 2020/04
Free full text
2070

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04
2071

Quels rôles pensent jouer les ostéopathes dans la prise en charge d’un patient pédiatrique : une étude qualitative
(What roles do osteopaths think they play in the management of a paediatric patient: a qualitative study)
Rohrbach, C.
Unpublished MSc thesis, 2020/04
Free full text
2072

Quelle tenue les ostéopathes portent-ils en cabinet en suisse et pourquoi ? Traduit-elle un positionnement par rapport au monde médical conventionnel ? : une étude qualitative
(What kind of dress do osteopaths wear in their Swiss practices, and why? Does it reflect a positioning in relation to the conventional medical world? A qualitative study)
Roth, T.
Unpublished MSc thesis, 2020/04
Free full text
2073

Understanding the professional identity development of undergraduate osteopathic students in the UK
McKenna, B.
Unpublished PhD thesis, 2020/04
Free full text
2074

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text
2075

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text
2076

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text
2077

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04
2078

Relationship of Clinical Skills Performance in Medical School With COMLEX-USA Level 2-Performance Evaluation
Wang, S., Basehore, P.
The Journal of the American Osteopathic Association, 2020/04
Free full text
2079

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text
2080

Osteopathic Manipulative Treatment Relieves Post-concussion Symptoms in a Case of Polytrauma
Baltazar, G. A., Kolwitz, C., Petrone, P., Stright, A., Joseph, D'A.
Cureus, 2020/04
Free full text
2081

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text
2082

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text
2083

Empathy in MedicineCultivating an Empathetic Professional Identity in Osteopathic Medical Students Through Service Learning: A Qualitative Analysis of Reflective Essays
Chrisman-Khawam, L. M., Manzi, J. A.
The Journal of the American Osteopathic Association, 2020/04
Free full text
2084

Überaktive Blase bei Frauen - der Zusatznutzen von Osteopathie zur Standardtherapie Blasentraining
(Overactive Bladder in Women - Benefit of osteopathy in addition to standard bladder-training)
Cecon, S.
Unpublished MSc thesis, 2020/03
Free full text
2085

Perception des effets d'un traitement ostéopathique sur la qualité et la pratique du chant : une étude qualitative
(Perceived effects of osteopathic treatment on the quality and practice of singing: a qualitative study)
Christe, C.
Unpublished MSc thesis, 2020/03
Free full text
2086

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text
2087

Osteopathic Manipulative Medicine in the Era of the Single Accreditation System: Can the Past Guide the Way to the Future of OMM?
Kanze, D.M.
The AAO Journal, 2020/03
Free full text
2088

Educating Leaders 2019: Abstracts From AACOM's Annual Conference
listed, No authors
The Journal of the American Osteopathic Association, 2020/03
Free full text
2089

Transitions: Our Own, Our Patients’, Our Profession’s
Newman, D.B.
The AAO Journal, 2020/03
Free full text
2090

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text
2091

A new perspective for Somatic Dysfunction in Osteopathy: the Variability Model
Bergna, A., Vismara, L., Parravicini, G., Farra, F.
Journal of Bodywork and Movement Therapies, 2020/03
2092

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text
2093

Effektivität osteopathischer Maßnahmen bei Dysgnathie-Patienten post operationem: Eine Pilotstudie
(Effectiveness of osteopathic measures in postoperative dysgnathia patients: A pilot study)
Rost, H., Makuch, A.
Osteopathische Medizin, 2020/03
2094

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
2095

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
2096

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text
2097

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03
2098

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03
2099

La prise en charge de la douleur testiculaire chronique due a un syndrome de charniere thoraco-lombaire : étude pilote
(Management of chronic testicular pain due to thoracolumbar junction syndrome: A pilot study)
Aoun, F., Malek, E., Kazan, D., Albisinni, S., Peltier, A., Bollens, R., Roumeguère, T.
Progres en urologie : journal de l'Association francaise d'urologie et de la Societe francaise d'urologie, 2020/03
2100

Barriers and facilitators experienced by osteopaths in implementing a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain – A mixed methods systematic review protocol
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Hanses, M., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/03
Free full text
2101

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
2102

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03
2103

Can referrals to a pediatric Osteopathic Manipulative Medicine (OMM) clinic be increased through provider education?
Sinha, A., Jimenez, E. Y.
UNMs Digital Repository, 2020/03
2104

An osteopathic approach to Graves’ ophthalmopathy: A case report
McDermott, G., Qureshi, Y., Foster-Moumoutjis, G., Espejo, A.
International Journal of Osteopathic Medicine, 2020/03
Free full text
2105

Pre-professional reflective practice: Strategies, perspectives and experiences
McLeod, G. A., Vaughan, B., Carey, I., Shannon, T., Winn, E.
International Journal of Osteopathic Medicine, 2020/03
2106

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
2107

A duty of candour: Implications for Australian osteopaths
Moore, K.
International Journal of Osteopathic Medicine, 2020/03
2108

Combining psychotherapy with craniosacral therapy for severe traumatized patients: A qualitative study from an outpatient clinic in Norway
Stub, T., Kiil, M., Lie, B., Kristoffersen, A., Weiss, T., Hervik, J., Musial, F.
Complementary Therapies in Medicine, 2020/03
2109

The Intraosseous Dysfunction in the Osteopathic Perspective: Mechanisms Implicating the Bone Tissue
Bicalho, E.
Cureus, 2020/03
Free full text
2110

A study of the factors impacting on workforce distribution of Australian osteopaths: The perspectives of osteopathic students, academics and clinicians
Steel, A., Dingle, T., Wardle, J., Adams, J.
International Journal of Osteopathic Medicine, 2020/03
2111

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03
2112

‘We need one more hour solely based on anatomy… Give us anatomy!’: Early-year learner perceptions of anatomy within an integrated & case-based learning osteopathy curriculum
Johnston, S. L., Vaughan, B.
International Journal of Osteopathic Medicine, 2020/03
2113

Comparative study of muscle energy technique, craniosacral therapy, and sensorimotor training effects on postural control in patients with nonspecific chronic low back pain
Ghasemi, C., Amiri, A., Sarrafzadeh, J., Dadgoo, M., Jafari, H.
Journal of Family Medicine and Primary Care, 2020/02
Free full text
2114

Osteopathic Manipulative Medical Assistant: A Proposed Allied Profession
Lennon, J. L.
The Journal of the American Osteopathic Association, 2020/02
Free full text
2115

Etude exploratoire de la sante musculo-squelettique du rachis d'etudiants en osteopathie.
[Exploratory study on spinal musculoskeletal health of osteopathy students]
Javerliat, P., Pizon, F., Gerbaud, L.
Revue d'epidemiologie et de sante publique, 2020/02
2116

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text
2117

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text
2118

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text
2119

Eine systematische Übersichtsarbeit über osteopathische manuelle Therapie bei Pneumonie
(Osteopathic Manual Treatment in Pneumonia: A systematic review)
Kafader, J. C.
Unpublished MSc thesis, 2020/02
Free full text
2120

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
2121

Die akute Sprunggelenksverletzung in der osteopathischen Praxis
(The acute ankle injury in osteopathic practice)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
2122

Attitudes Toward Osteopathic Recognition Under the Single GME Accreditation System: A Survey of Deans at Colleges of Osteopathic Medicine and Chairs of Osteopathic Manipulative Medicine Departments
Dougherty, J. J., Bray, N. N., Vanier, C. H.
The Journal of the American Osteopathic Association, 2020/01
Free full text
2123

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text
2124

U.S. Physician Recommendations to Their Patients About the Use of Complementary Health Approaches
Stussman, B. J., Nahin, R. R., Barnes, P. M., Ward, B. W.
The Journal of Alternative and Complementary Medicine, 2020/01
Free full text
2125

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text
2126

The architecture and spatial organization of the living human body as revealed by intratissular endoscopy – An osteopathic perspective
Armstrong, C.
Journal of Bodywork and Movement Therapies, 2020/01
Free full text
2127

High-velocity, low-amplitude manipulation (HVLA) does not alter three-dimensional position of sacroiliac joint in healthy men: A quasi-experimental study
de Toledo, D., Kochem, F. B., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2020/01
2128

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01
2129

Preserving osteopathic antiquity through historical pamphlets and postcards
Fitterling, L. A., Oro, R.
Journal of the Medical Library Association, 2020/01
2130

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01
2131

Tratamento manipulativo osteopático em Unidade de Terapia Intensiva Neonatal / Osteopathic manipulative treatment in a neonatal intensive care unit
(Osteopathic manipulative treatment in a neonatal intensive care unit)
dos Santos Varela, A. P. A., Yasojima, E. Y., Gonçalves, H. M. T., Silvestre, L. C., Tannus, L. O.
Brazilian Journals Publicações de Periódicos e Editora Ltda, 2020/01
2132

Introducing national osteopathy practice-based research networks in Australia and New Zealand: an overview to inform future osteopathic research
Steel, A., Peng, W., Sibbritt, D., Adams, J.
Scientific Reports, 2020/01
Free full text
2133

The use of complementary medicine in palliative care in France: an observational cross-sectional study
Filbet, M., Schloss, J., Maret, J.-B., Diezel, H., Palmgren, P. J., Steel, A.
Supportive care in cancer, 2020/01
2134

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text
2135

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01
2136

Burnout, Perceived Stress, Sleep Quality, and Smartphone Use: A Survey of Osteopathic Medical Students
Brubaker, J. R., Beverly, E. A.
The Journal of the American Osteopathic Association, 2020/01
Free full text
2137

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text
2138

Im Gespräch mit … Professor Karl-Ludwig Resch
(In dialog with...Professor Karl-Ludwig Resch)
Engemann, K. Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
2139

Forschung und Osteopathie – ein Widerspruch? Ein Versuch der Auflösung am Beispiel des DO-Touch.Net
(Research and Osteopathy - a contradiction? An approach to solution using the example of DO-Touch.Net)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
2140

Das cerebrospinale venöse System: Anatomie, Physiologie und Pathologie diskutiert im Kontext der Osteopathie
(The cerebrospinal venous system: anatomy, physiology and pathology in the context of osteopathy)
Flenker, J.
Unpublished MSc thesis, 2020/01
Free full text
2141

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020
2142

Global review of osteopathic medicine and osteopathy 2020
, 2020
2143

A Comparative Study of the Heart as a Fulcrum in Relation to the Central Chain and the Ancient Wisdom of the Pervuvian Healers
Friesecke, D.
Unpublished D.O. thesis, 2019/5
Free full text
2144

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text
2145

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text
2146

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text
2147

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text
2148

Influence of postoperative adhesions after caesarean section on chronic lower back pain – A pilot study of osteopathic manipulative treatment
Liedler, M., Woisetschläger, G.
European Journal of Osteopathic Research, 2019/12
Free full text
2149

An Osteopathic Approach to Traumatically Induced Mechanical Dyspnea: A Case Report
Kanze, D. M.
The AAO Journal, 2019/12
Free full text
2150

Characteristics, Opportunities, and Challenges of Osteopathy (COCO) in the Perceptions of Osteopaths in Germany, Austria, and Switzerland: Protocol for a Comprehensive Mixed Methods Study
Porthun, J., Manschel, J.
JMIR Research Protocols, 2019/12
Free full text
2151

Applying Osteopathic Manipulative Treatment to Postconcussion Syndrome: A Case Report
Yao, S. C.
The AAO Journal, 2019/12
Free full text
2152

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text
2153

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text
2154

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text
2155

Complaint risk among mental health practitioners compared with physical health practitioners: A retrospective cohort study of complaints to health regulators in Australia
Veness, B. G., Tibble, H., Grenyer, B. F., Morris, J. M., Spittal, M. J., Nash, L., Studdert, D. M., Bismark, M. M.
BMJ Open, 2019/12
Free full text
2156

Osteopathic correction of somatic dysfunctions in preschool children with delayed speech development
(Остеопатическая коррекция соматических дисфункций у детей дошкольного возраста с задержкой речевого развития)
Abramova, E. V., Aptekar, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
2157

Constipation in Parkinson’s Disease Improved by an Osteopathic Manipulative Medicine Sequence in a Repeated Measures Study
Valasareddi, S., Mathai, M., Li, T. S., Yao, S. C., Mancini, J.
The Journal of the American Osteopathic Association, 2019/12
2158

Justification of the use of osteopathic correction in the complex rehabilitation of patients with consolidated fractures of the large tubercle of the humerus
(Обоснование применения остеопатической коррекции в комплексной реабилитации больных с консолидированными переломами большого бугорка плечевой кости)
Bogachev, A. A., Kutuzov, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
2159

The role of generalized muscule hyperfacilitation in pathogenesis and clinical picture of myofascial pain syndrome. Possible option of its correction
(Роль генерализованной мышечной гиперфасилитации в патогенезе и клинической картине миофасциального болевого синдрома. Возможный вариант её коррекции)
Boldin, A. V., Agasarov, L. G., Tardov, M. V., Bokova, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
2160

Possibilities of osteopathic correction of somatic dysfunctions in children with chronic adenoiditis
(Возможности остеопатической коррекции соматических дисфункций у детей с хроническим аденоидитом)
Chaiko, E. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2019/12
Free full text
2161

Correlation between certain rhythms of the body in osteopathic patients
(Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
2162

Efeitos da manipulação osteopática em trabalhadores feirantes com dor lombar crônica inespecífica: ensaio clínico randomizado
(Effects of osteopathic manipulation in fairground workers with chronic nonspecific low back pain: randomized clinical trial)
Estrázulas, J. A.
Unpublished MSc thesis, 2019/12
Free full text
2163

Secondary effects and quality of life with chemotherapy: assessing the impact of an osteopathic treatment (multicentric randomized clinical trial
(Побочные эффекты и качество жизни пациентов при химиотерапии: оценка влияния остеопатической коррекции (многоцентровое рандомизированное клиническое исследование)
Favier, N., Guinet, A. G., Nageleisen, M., Ceccaldi, B., Pujade-Lauraine, E., LeFoll, C., Soudain-Pineau, M., Turlin, C., Stubbe, L.
Russian Osteopathic Journal, 2019/12
Free full text
2164

Possibilities of using osteopathic correction in treatment of combined forms of infertility
(Возможности применения остеопатической коррекции в лечении сочетанной формы бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2019/12
Free full text
2165

Osteopathy In The Cranial Field As A Method To Enhance Injury Recovery: A Preliminary Study
Brolinson, P. G., Hyppolite, N. A., Dickerson, M. R., Murphy, S. F., VandeVord, P. J.
The Journal of the American Osteopathic Association, 2019/12
2166

Developing “Migraneous” Rat Models to Evaluate the Efficacy of OMT on Various Migraine Biomarkers
Byrd, K. E., Gregory, C., Krishna, S., Xie, J. Y., Fleming, R. K.
The Journal of the American Osteopathic Association, 2019/12
2167

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12
2168

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
The Journal of the American Osteopathic Association, 2019/12
2169

Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis
(Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
2170

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12
2171

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
The Journal of the American Osteopathic Association, 2019/12
2172

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12
2173

Tension-type headache in patients with concomitant musculoskeletal disorders
(Головная боль напряжения у пациентов с сопутствующей скелетно-мышечной патологией)
Novikov, Y. O., Salakhov, I. E.
Russian Osteopathic Journal, 2019/12
Free full text
2174

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
The Journal of the American Osteopathic Association, 2019/12
2175

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
The Journal of the American Osteopathic Association, 2019/12
2176

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/12
2177

Clinical efficacy of osteopathic correction in the complex treatment of patients with unoperated open-angle glaucoma
(Клиническая эффективность остеопатической коррекции в комплексном лечении больных с неоперированной открытоугольной глаукомой)
Simakova, E. N., Stenkova, O. V.
Russian Osteopathic Journal, 2019/12
Free full text
2178

Osteopathic support of sportsmen during the annual training process
(Остеопатическое сопровождение спортсменов в годовом тренировочном процессе)
Yakupov, R. A., Safiullina, G. I., Safiullina, A. A., Burganov, E. R.
Russian Osteopathic Journal, 2019/12
Free full text
2179

Myofascial Release for Vulvar Pain and Pubic Shear After a Straddle Injury in a 3-Year-Old Girl
Dade, M. M., Broecker, J. D.
The Journal of the American Osteopathic Association, 2019/11
Free full text
2180

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
2181

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text
2182

Effect of Osteopathic Cranial Manipulative Medicine on an Aged Rat Model of Alzheimer Disease
Tobey, H., Lucas, T., Bledsoe, D., Mykins, M., Campbell, C., Berr, S. S., Sasser, T., Helm, R., Brolinson, P. G., Klein, B. G., Costa, B. M.
The Journal of the American Osteopathic Association, 2019/11
Free full text
2183

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text
2184

Experience with and perception of research among first year osteopathic medical students
Jackson, K., Ogunbekun, O., Zahl, S., Lowery, J.
Poster presentation, 2019/11
2185

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11
2186

Osteopathic manipulative medicine to improve balance and quality of life in parkinson disease
Yao, S., Docherty, J., Mancini, J., Leder, A., DiFrancisco-Donoghue, J.
Movement Disorders, 2019/11
2187

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text
2188

The Benefits and Limitations of Evidence-based Practice in Osteopathy
Bordoni, B.
Cureus, 2019/11
Free full text
2189

Psychological context effects of participant expectation on pain pressure thresholds as an adjunct to cervicothoracic HVLA thrust manipulation: A randomised controlled trial
Shackleton, E., Toutt, C., Edwards, D. J.
International Journal of Osteopathic Medicine, 2019/11
2190

Einfluss von Osteopathie auf die gesundheitsbezogene Lebensqualität von Frauen nach Sectio caesarea
(Influence of osteopathy on the health-related quality of life of women after caesarean section)
Rehak, M.
Unpublished MSc thesis, 2019/10
2191

Führt eine viszerale Pumptechnik der Leber an gesunden Probanden zu einer verbesserten Gleitfähigkeit der nervalen Strukturen, überprüft durch den passiven SLR-Test?
(Does a visceral pumping technique of the liver lead to an improved gliding of the neural structures, field-tested by the passive SLR Test on healthy probands?)
Nagenkögl, P.
Unpublished MSc thesis, 2019/10
Free full text
2192

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text
2193

Die Anwendung osteopathischer Techniken zur Behandlung bei chronisch obstruktiver Lungenerkrankung (COPD)
(The use of osteopathic techniques in the management of the chronic obstructive pulmonary disease (COPD))
Lebersorger, P.
Unpublished MSc thesis, 2019/10
Free full text
2194

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
2195

Osteopathie zur Behandlung von Schlafstörungen bei Kindern: Eine klinische Studie mit Drei- bis Sechsjährigen
(Osteopathy for the Treatment of Sleep Disturbances of Children: A Clinical Study Among 3-6 Year Olds)
Ellersdorfer, A.
Unpublished MSc thesis, 2019/10
Free full text
2196

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text
2197

Einfluss einer osteopathischen Behandlung der vier Diaphragmen des Rumpfes nach Zink auf die Bewegungen des Center of pressure von Personen mit Rückenbeschwerden
(The impact of an osteopathic treatment of the four diaphragms after Zink on the movement of the center of pressure of individuals with back pain)
Arztmann, A.
Unpublished MSc thesis, 2019/10
Free full text
2198

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10
2199

A.T. Still und der Methodismus. Einfluss des Methodismus auf A.T. Stills Entwicklung der osteopathischen Lehre und Praxis im Amerika des 19. Jahrhunderts
(A.T. Still and the Methodism)
Liem, T.
Osteopathische Medizin, 2019/10
2200

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10
2201

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
2202

Understanding the role of osteopathic manipulative medicine in the management of gastrointestinal disorders and symptoms: a survey study
Shah, R. N., Diehl, D. L., Graham, J., Kim, A. H., Loughlin, M. T.
The American Journal of Gastroenterology, 2019/10
Free full text
2203

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10
2204

Osteopathie bei Spondylitis ankylosans (Morbus Bechterew)
(Osteopathy in ankylosing spondylitis (Bechterew's disease))
Gugganig, K.
Unpublished MSc thesis, 2019/10
Free full text
2205

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text
2206

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
2207

Einfluss der osteopathischen Behandlung im Rahmen der stationären Anschlussheilbehandlung bei Patienten mit Zustand nach Hüft-TEP-Implantation. Randomisierte kontrollierte Studie.
(Influence of osteopathic treatment during post-hospital curative treatment in patients after total hip arthroplasty. A randomized controlled trial)
Behm, B., Mattern, E. R.
Unpublished D.O. thesis, 2019/10
2208

Exploring the lived experience of osteopathy students making the transition from working in student clinic (8 hours per week) to working full-time (40 hours per week) during the summer holiday break
Garelja, D.
Unpublished MSc thesis, 2019/10
Free full text
2209

Wechselbeziehung von Mittelohrpathologien und Mobilität des Os temporale bei Säuglingen mit Lippen-Kiefer-Gaumenspalten - ein Pilotprojekt
(Middle Ear Pathologies and the Mobility of the Temporal Bone in Children with Cleft Lip and Palate - A Pilot Study)
Wedenig, K.
Unpublished MSc thesis, 2019/10
2210

Können osteopathische Behandlungen Einfluss auf die Intensität und Dauer der Schmerzen bei Frauen mit primärer Dysmenorrhoe nehmen? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with primary dysmenorrhea. A randomized controlled trial)
Plathner, M., Wolf, L.
Unpublished D.O. thesis, 2019/10
2211

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text
2212

Einfluss osteopathischer Behandlung der Fascia thoracolumbalis bei chronisch unspezifischen Rückenschmerzen
(The influence of osteopathic treatment on the thoracolumbar fascia in case of chronic non-specific low back pain)
Putz, F.
Unpublished MSc thesis, 2019/10
Free full text
2213

Does Compression of the Fourth Ventricle Cause Preterm Labor? Analysis of Data From the PROMOTE Study
Hensel, K. L., Roane, B. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
2214

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
2215

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09
2216

Effektivität einer osteopathischen Therapie auf das autonome Nervensystem: Eine systematische Übersichtsarbeit
(Effectiveness of an osteopathic treatment on the autonomic nervous system A systematic review of the literature)
Rechberger, V.
Unpublished MSc thesis, 2019/09
Free full text
2217

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09
2218

Das Restless-Legs-Syndrom und die Nierenregion - Können osteopathische Behandlungen die Symptome verbessern?
(The Restless Legs Syndrome and Kidney Region - Can Osteopathic Treatment Influence the Symptoms?)
Lotz, S.
Unpublished MSc thesis, 2019/09
Free full text
2219

Counterstrain as a Diagnostic and Treatment Tool for Rectus Femoris Origin Injuries: A Case Report
Goering, E. K., Qiu, L.
The AAO Journal, 2019/09
Free full text
2220

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text
2221

Evaluating the Influence of Research on Match Success for Osteopathic and Allopathic Applicants to Residency Programs
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M., Roberts, M. B.
The Journal of the American Osteopathic Association, 2019/09
Free full text
2222

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
2223

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09
2224

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
2225

Im Gespräch mit … dem Wissenschaftsteam der Wiener Schule für Osteopathie
(In dialog with ... the science team of the Vienna School of Osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
2226

Student Perceived Value of Reading Assignments During Mandatory Clerkship-Years OMM Course
Lewis, D. D., Pickos, J. J.
The AAO Journal, 2019/09
Free full text
2227

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text
2228

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy in somatoform disorders - Systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
Free full text
2229

Patient Education of Osteopathic Manipulative Medicine as a Gateway to Treatment: A Pilot Study
Majetich, S. A., Majetich, M. W., Clegg, J. M., Ratay, S. M.
The AAO Journal, 2019/09
Free full text
2230

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
2231

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
2232

Welches Gesundheitsmodell hat die Osteopathische Medizin? Teil 2: Eine osteopathische Sichtweise zur Gesundheit und zum Gesundsein
(What health model does osteopathic medicine have? Part 2)
Mayer, J.
Osteopathische Medizin, 2019/09
2233

Effektivität der osteopathischen Behandlung eines Maldescensus testis bei Kindern im Alter von neun Monaten bis sechs Jahren
(Effectiveness of the osteopathic treatment of maldescensus testis in children from 9 months to 6 years of age)
Roch, U.
Unpublished MSc thesis, 2019/09
Free full text
2234

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
2235

Integrating Osteopathic Evaluation and Treatment in a Case Report of Acute Chest Pain
Yao, S. C.
The AAO Journal, 2019/09
Free full text
2236

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09
2237

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09
2238

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects: A randomized control trial
Abdelfattah, A. S. I.
Annals of Clinical and Analytical Medicine, 2019/09
2239

Temporomandibuläre Dysfunktion (TMD) mit Diskusprolaps
(Temporomandibular dysfunction (TMD) with discus prolapse: Case study on the efficacy of osteopathic treatment)
Vathrakokoilis, K., Liem, T., Aetopoulos, I., Antoniadis, K., Triantafyllidou, E.
Osteopathische Medizin, 2019/09
2240

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text
2241

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text
2242

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text
2243

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text
2244

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09
2245

A Literature Review of Osteopathic Manipulative Techniques for Otalgia
Lindsey, T., Lawson, R., Hiffernan, F.
Osteopathic Family Physician, 2019/09
2246

Beschleunigungstrauma der Halswirbelsäule
(Whiplash injury in the cervical spine)
Belz, S., Baum, N.
Osteopathische Medizin, 2019/09
2247

The effects of a 4-week barefoot exercise intervention on plantar pressure, impact, balance and pain in injured recreational runners: A pilot study
Rowlands, C., Plumb, M. S.
International Journal of Osteopathic Medicine, 2019/09
2248

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text
2249

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09
2250

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, Jacob Marten, Podar, Stefan, Perraton, Luke, Machotka, Zuzana
International Journal of Osteopathic Medicine, 2019/09
2251

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
2252

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
2253

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text
2254

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
2255

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
2256

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08
2257

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08
2258

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text
2259

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text
2260

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08
2261

Stretch Receptor and Somatic Dysfunction: A Narrative Review
Andrews, M. A. W.
The Journal of the American Osteopathic Association, 2019/08
2262

Revisión sistemática de la terapia osteopática en el tratamiento del Síndrome del túnel del carpo
(Efficacy of osteopathic therapy in the management of carpal tunnel syndrome)
Mesa Palacio, A. M.
Unpublished MSc thesis, 2019/08
Free full text
2263

Effectiveness of craniosacral therapy in the treatment of infantile colic. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Martínez Gil, J. L., Todri, J., Suárez Rancel, M., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2019/08
2264

Mecanismo mediante el cual la osteopatía libera las emociones
(The Mechanism by which osteopathy releases emotions)
Ospina Guisao, M. C.
Unpublished MSc thesis, 2019/08
Free full text
2265

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08
2266

Novel Approach to Introducing an Ultrasonography Curriculum With Limited Instructor Resources
Evans, D. K., Thiessen, M. E. W.
The Journal of the American Osteopathic Association, 2019/08
Free full text
2267

Empathy in Medicine National Norms for the Jefferson Scale of Empathy: A Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
2268

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
2269

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
2270

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
2271

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
2272

WVSOM Anatomy Lab Tour Program: An Osteopathic Medicine Pipeline With Student Teaching Opportunities
Wines, K. S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
2273

An investigation of Australian osteopaths’ attitudes, skills and utilisation of evidence-based practice: a national cross-sectional survey
Leach, M. J., Sundberg, T., Fryer, G., Austin, P., Thomson, O. P., Adams, J.
BMC Health Services Research, 2019/07
Free full text
2274

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text
2275

Differences in Function and Comorbidities Between Older Adult Users and Nonusers of Chiropractic and Osteopathic Manipulation: A Cross-sectional Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2019/07
2276

The influence of osteopathic correction on the restoration of the functions of the ankle joint with partial damage of its ligaments
(Влияние остеопатической коррекции на восстановление функций голеностопного сустава при частичном повреждении его связок)
Alekseev, V. N., Naumenko, E. Y.
Russian Osteopathic Journal, 2019/07
2277

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text
2278

Results of osteopathic correction of patients with post-traumatic coccygodynia
(Результаты остеопатической коррекции у пациентов с посттравматической кокцигодинией)
Antonova, Y. V., Iskandarov, A. M., Mizonova, I. B.
Russian Osteopathic Journal, 2019/07
2279

La lumbalgia: La visión desde la osteopatía y medicina tradicional del Palenque San Basilio
(Low back pain: The vision of osteopathy and traditional medicine of Palenque San Basilio)
Ayala Ardila, D. P.
Unpublished MSc thesis, 2019/07
Free full text
2280

Сhange in the functional activity of fibroblasts in the process of modelling of compression, hypercapnia and hypoxia
(Изменение функциональной активности фибробластов в процессе моделирования компрессии, гиперкапнии и гипоксии)
Aptekar, A. I., Kostolomova, E. G., Sukhovey, Y. G.
Russian Osteopathic Journal, 2019/07
2281

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
2282

The influence of osteopathic correction on the rate of various rhythms of the body
(Влияние остеопатической коррекции на частоту различных ритмов организма)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
2283

Reflective practice enhances osteopathic clinical reasoning
McIntyre, C., Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2019/07
2284

Verbesserte Neudefinition des Fasziensystems.
Improving the New Definition of Fascial System
Bordoni, B.
Complementary Medicine Research, 2019/07
2285

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07
2286

The effectiveness of additional treatment methods for post-stroke periarthropathy of the shoulder joint
(Эффективность дополнительных методов лечения постинсультной периартропатии плечевого сустава)
Kozlova, N. S., Amelin, A. V.
Russian Osteopathic Journal, 2019/07
2287

Possibilities of osteopathic correction in complex therapy of temporomandibular joint dysfunction
(Возможности остеопатической коррекции в комплексной терапии дисфункции височно-нижнечелюстного сустава)
Milutka, Y. A., Yushmanov, I. G., Badmaeva, A. N.
Russian Osteopathic Journal, 2019/07
2288

Randomized controlled study of the effectiveness of osteopathic manipulative correction for muscular torticollis due to birth injury
(Рандоминизированное контролируемое исследование эффективности остеопатической манипуляционной коррекции при мышечной кривошее вследствие родовой травмы)
Novikov, Y. O., Mokhov, D. E., Amigues, J.P., Musina, G. M., Shaiakhmetov, A. R.
Russian Osteopathic Journal, 2019/07
2289

Change of skin electrical activity during osteopathic correction with the use of biodynamical approach
(Изменение электрической активности кожи во время остеопатического воздействия с применением биодинамического подхода)
Novikov, Y. O., Shaiakhmetov, A. R., Musina, G. M.
Russian Osteopathic Journal, 2019/07
2290

Osteopathic correction in complex treatment of carpal tunnel syndrome with complicated closed forearm fractures
(Остеопатическая коррекция в комплексном лечении синдрома карпального канала при закрытых осложненных переломах предплечья)
Sebaykin, Y. V., Mokhov, D. E., Tarusova, K. S., Nechoroshev, S. N.
Russian Osteopathic Journal, 2019/07
2291

The influence of osteopathic correction on the viscoelastic characteristics of the lower leg muscles
(Влияние остеопатической коррекции на вязкоупругие характеристики мышц голени)
Timanin, E. M., Sydneva, N. S., Zakharova, A. A.
Russian Osteopathic Journal, 2019/07
2292

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text
2293

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
2294

The Combined Shoulder Technique: A Novel Approach in the Treatment of Scapular Dysfunction—A Case Report
Kanze, D. M.
The AAO Journal, 2019/06
Free full text
2295

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06
2296

Osteopathische Behandlung bei Pertussis im 19. und 20. Jahrhundert
Osteopathic treatment of pertussis in the 19th and 20th centuries: A structured historical literature review
Liem, T.
Osteopathische Medizin, 2019/06
2297

Restoring Full Squat Range of Motion by Applying OMT to Superior Innominate Shear: A Case Report
Lewis, D. D., Pickos, J.
The AAO Journal, 2019/06
Free full text
2298

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06
2299

Welches Gesundheitsmodell hat die Osteopathische Medizin?
(What health model does osteopathic medicine have? Part 1: The topic of disease in the biomedical model of standard care)
Mayer, J.
Osteopathische Medizin, 2019/06
2300

Osteopathische Medizin: Versuch einer zeitgemäßen Definition
(Osteopathic medicine: Attempt at a contemporary definition)
Mayer, J., Pelz, H., Riedel, M.
Osteopathische Medizin, 2019/06
2301

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06
2302

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06
2303

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06
2304

A Study to Investigate the Effect of ‘Frontal Lift’ Osteopathic Manipulative Technique (OMT) in Patients with Chronic Sinusitis
Lintonbon, David
American Journal of Biomedical Science & Research, 2019/06
2305

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06
2306

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
2307

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood & Cancer, 2019/06
2308

¿La Manipulación Osteopática Mejora la Función Mecánica y Física y la Simetría Espinal en Golfistas?
(Does Osteopathic Manipulation Lead to Improvements in Physical and Muscle Mechanical Function and Spinal Symmetries in Golfers?)
Rojas-Valverde, D., Sánchez García, A., Sáez Ulloa, D., Gutiérrez-Vargas, R.
Kronos, 2019/06
Free full text
2309

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06
2310

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
2311

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06
2312

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06
2313

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text
2314

The New Zealand Osteopathic Profession’s Understanding of Continuing Professional Development
Fairs, E. J.
Unpublished MSc thesis, 2019/06
Free full text
2315

A systematic review of non-invasive manual therapies in the management of irritable bowel syndrome
Badenhorst, N.
Unpublished MSc thesis, 2019/06
2316

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06
2317

OSLO – Effets d’un traitement ostéopathique manuel sur la lombalgie non spécifique aiguë dans un service d’accueil des urgences : un protocole d’essai randomisé contrôlé monocentrique
(OSLO – Effects of osteopathic manipulative therapy for acute nonspecific low back pain in emergency room: design of a randomised monocentric controlled trial)
Ginier-Gillet, M.
Unpublished MSc thesis, 2019/06
2318

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06
2319

Osteopathic Approach to the Treatment of a Patient With an Atypical Presentation of Coccydynia
Alexandre, K., Channell, M. K.
The Journal of the American Osteopathic Association, 2019/06
Free full text
2320

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text
2321

A Case of Venous Thoracic Outlet Syndrome: Primary Care Review of Physical Exam Provocative Tests and Osteopathic Manipulative Technique Considerations
Yuschak, E., Haq, F., Chase, S.
Cureus, 2019/06
Free full text
2322

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text
2323

Einfluss von Osteopathie auf die Symptomatik, Häufigkeit und die Medikamenteneinnahme von PatientInnen mit episodisch-häufigem Spannungskopfschmerz
(Impact of Osteopathic Treatment on Frequent Tension-type Headache)
Huemer, D.
Unpublished MSc thesis, 2019/05
Free full text
2324

Unterschiede in der viszeralen Dysfunktion bei Frauen mit Nullipara in Abhängigkeit vom Trendelenburg-Zeichen
(Differences in the visceral dysfunction in nullipara women as a function of the Trendelenburg sign)
Brösenhuber, S.
Unpublished MSc thesis, 2019/05
Free full text
2325

Der Einfluss einer viszeralen osteopathischen Behandlung auf das Bewegungsausmaß des straight leg raising tests am rechten und linken Bein beim akuten lateralen Bandscheibenvorfall
(The influence of visceral osteopathic treatment on the level of movement of the „straight leg raising tests“ on the left and right leg in case of an acute lateral herniated disc)
Akkoc, Ö.
Unpublished MSc thesis, 2019/05
Free full text
2326

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text
2327

Survey of Osteopathic Medical Students Regarding Physician Shadowing Experiences Before and During Medical School Training
Langenau, E., Frank, S. B., Calardo, S. J., Roberts, M. B.
Journal of Medical Education and Curricular Development, 2019/05
Free full text
2328

A National Evaluation of Scholarly Activity Requirement in Osteopathic EM Residency Programs: Survey of EM Program Directors
Kirkpatrick, A., Doran, T., Mullins, D., Gnugnoli, D., Ashurst, J.
Southern Medical Journal, 2019/05
2329

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text
2330

Desenvolvimento de técnicas manipulativas osteopáticas para tratamento da síndrome do impacto do ombro baseado na biomecânica
(Development of osteopathic manipulative technique for impingement syndrome of shoulder treatment based on the biomechanics)
Louro, S. M.
Unpublished MSc thesis, 2019/05
Free full text
2331

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05
2332

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
2333

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text
2334

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05
2335

Systematische Übersichtsarbeit über die physiologischen Vorgänge bei verschiedenen Abwehrreaktionen mit Schwerpunkt auf das viszerale System
(Systematic review of the physiological responses to various defense reactions with a focuson the visceral system.)
Wyvekens, J.
unpublished D.O. thesis, 2019/05
Free full text
2336

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text
2337

Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative pilot study of osteopathy and electrostimulation /biofeedback for pelvic floor
Bogner, D.
European Journal of Osteopathic Research, 2019/04
Free full text
2338

Role of Debt and Loan Forgiveness/Repayment Programs in Osteopathic Medical Graduates' Plans to Enter Primary Care
Scheckel, C. J., Richards, J., Newman, J. R., Kunz, M., Fangman, B., Mi, L., Poole, K. G.
The Journal of the American Osteopathic Association, 2019/04
Free full text
2339

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04
2340

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text
2341

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text
2342

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text
2343

Osteopathic Manipulative Treatment in a Paediatric Patient with Oesophageal Atresia and Tracheo-Oesophageal Fistula
Barni, A., Zecchillo, D., Uberti, S., Ratti, S.
Gastroenterology, 2019/04
2344

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text
2345

Analyse comparative entre la thérapie manuelle orthopédique et l'ostéopathie une mise au point sur la situation en Belgique
(Comparative analysis between orthopaedic manual therapy and osteopathy: Focus on the Belgian situation)
Hidalgo, B., Demoulin, C.
Revue Medicale de Liege, 2019/04
Free full text
2346

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text
2347

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04
2348

Empathy, Religious Affiliation, and the Growth of Osteopathic Medicine
Cunningham, B.
Unpublished PhD thesis, 2019/04
Free full text
2349

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04
2350

Prevalence and profile of Australian osteopaths treating older people
Steel, A., Vaughan, B., Orrock, P., Peng, W., Fleischmann, M., Grace, S., Engel, R. M., Sibbritt, D., Adams, J.
Complementary Therapies in Medicine, 2019/04
2351

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04
2352

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text
2353

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
2354

Von der Biomechanik zur Bioinformatik
(From Biomechanic to Bioinformatics)
Eckardt, P.
Osteopathische Medizin, 2019/04
2355

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text
2356

Evaluation of teaching in a student-led clinic environment: Assessing the reliability of a questionnaire
Vaughan, B.
International Journal of Osteopathic Medicine, 2019/03
2357

Patient satisfaction and perception of treatment in a student-led osteopathy teaching clinic: Evaluating questionnaire dimensionality and internal structure, and outcomes
Vaughan, B., Burns, C., Burridge, L., Wigger, J., Blair, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2019/03
2358

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text
2359

Un audit clinique ostéopathique visant à décrire les procédures d’examen, de diagnostic, de traitement et de consentement chez des patientes présentant des douleurs pelviennes chroniques : projet de recherche
(An osteopathic clinical audit to describe examination, diagnosis, treatment and consent procedures in patients with chronic pelvic pain: a research project)
Cettou, N.
Unpublished MSc thesis, 2019/03
Free full text
2360

Ernährungswissen von Osteopathinnen und Osteopathen
(Knowledge of Nutrition Issues among Osteopaths)
Putschögl, J.
Unpublished MSc thesis, 2019/03
Free full text
2361

Facteurs déterminants du processus décisionnel de la prise en charge du hallux valgus par les ostéopathes : une approche par la théorie du jugement social
(Determinants of the decision-making process in the management of hallux valgus by osteopaths: a social judgment theory approach)
Kaeppeli, C.
Unpublished MSc thesis, 2019/03
Free full text
2362

Die Rolle der mentalen Vorstellung in der Palpation von Osteopathen
(The role of mental imagery in osteopathic palpation)
Kraml, M.
Unpublished MSc thesis, 2019/03
Free full text
2363

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text
2364

Effektivität von Osteopathie bei Patientinnen mit lumbalen Rückenschmerzen und/oder Beckengürtelschmerzen in der Schwangerschaft und Post Partum - systematic review
(The effectiveness of osteopathy for low back pain and pelvic girdle pain during and after pregnancy - a systematic review)
König, M.
Unpublished MSc thesis, 2019/03
Free full text
2365

Der Effekt von osteopathischen Behandlungen auf das Tagesprofil des Speichelcortisols
(The effect of osteopathic treatments on the diurnal profile of salivary cortisol)
Hämmerli, U.
Unpublished MSc thesis, 2019/03
Free full text
2366

Exploration des méthodes d’identification et des stratégies de gestion du stress et de l’anxiété des patients par l’ostéopathe : étude qualitative
(Exploring methods of identification and strategies for management of patient stress and anxiety by the osteopath: a qualitative study)
Piaget, B.
Unpublished MSc thesis, 2019/03
Free full text
2367

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text
2368

Dans quelle mesure la prise en charge ostéopathique des gonalgies chez les adolescents et les adultes est en concordance avec les bonnes pratiques ? : un sondage
(To what extent is osteopathic management of gonalgia in adolescents and adults in line with good practice? A survey)
Rossier, F.
Unpublished MSc thesis, 2019/03
Free full text
2369

Le modèle bio-psycho-social dans l’enseignement de l’ostéopathie : projet de recherche
(The bio-psycho-social model in osteopathic education: a research project)
Simonin, A.
Unpublished MSc thesis, 2019/03
Free full text
2370

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
2371

Osteopathie bei Bone Bruise
(Osteopathy for bone bruise)
Bick, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
2372

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
2373

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
2374

Die Kinderosteopathie aus Sicht der Kinderärzte. Eine qualitative Interview-Studie
(Pediatric osteopathy: What registered pediatricians think about it - A qualitative interview study)
Seidner, K., Belz, S.
Osteopathische Medizin, 2019/03
2375

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text
2376

Benefits and harms of spinal manipulative therapy for the treatment of chronic low back pain: systematic review and meta-analysis of randomised controlled trials
Rubinstein, S. M., de Zoete, A., van Middelkoop, M., Assendelft, W. J. J., de Boer, M. R., van Tulder, M. W.
The BMJ, 2019/03
Free full text
2377

Klinische und osteopathische Bedeutung der beidseitigen Blutdruckmessung. Nützlich bei “Thoracic outlet Syndrome“?
(Clinical and osteopathic significance of bilateral blood pressure measurement. Useful with “Thoracic outlet syndrome“?)
Stattin, E.
Unpublished MSc thesis, 2019/03
Free full text
2378

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
2379

Dancers’ experience of osteopathy and their attitudes towards dance injuries
Maddren, K.
Unpublished MSc thesis, 2019/03
Free full text
2380

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text
2381

Does somatic dysfunction lead to lower extremity injuries in the high school soccer player?
Wisinski, J., Lipp, T., Dougherty, J. J.
Clinical Journal of Sport Medicine, 2019/03
2382

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03
2383

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03
2384

Reflecting on new models for osteopathy – it's time for change
Smith, D.
International Journal of Osteopathic Medicine, 2019/03
2385

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03
2386

Reliabilitätsstudie des Befunds nach dem Mechanical Link
(Reliability study of the findings according to the mechanical link: Methodological study on the assessment of findings of the bones and joints of the extremities by the mechanical link method)
Hafen, G. I.
Osteopathische Medizin, 2019/03
2387

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text
2388

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text
2389

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02
2390

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02
2391

Osteopathic Manipulative Treatment for Pertussis in the 19th and 20th Centuries: A Structured Historical Literature Review
Liem, T.
The Journal of the American Osteopathic Association, 2019/02
Free full text
2392

To what extent do New Zealand osteopathic students meet the national requirements for clinical record keeping: an audit
Dyer, B. D.
Unpublished MSc thesis, 2019/02
Free full text
2393

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02
2394

Making sense of cranial osteopathy : an interpretative phenomenological analysis.
Banton, A
Unpublished PhD thesis, 2019/02
2395

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text
2396

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text
2397

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text
2398

Exploration of the characteristics of German osteopaths and osteopathic physicians: survey development and implementation
Dornieden, R.
Unpublished PhD thesis, 2019/01
Free full text
2399

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
2400

Zentralbahnhof Thorax
(Central station: thorax)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
2401

Osteopathische Behandlung bei akut traumatischen Zuständen: die Kraft der Flüssigkeiten
(Osteopathic treatment for acute traumatic conditions: the power of fluids)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
2402

Nonpharmacologic Management of Symptoms in Females With Polycystic Ovary Syndrome: A Narrative Review
Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text
2403

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text
2404

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text
2405

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01
2406

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text
2407

Investigating interpretation of ACC claims in an osteopathy teaching clinic
Urgert, C.
Unpublished MSc thesis, 2019/01
Free full text
2408

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01
2409

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text
2410

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text
2411

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text
2412

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text
2413

Die Zukunft der Osteopathie liegt in der Aktivität
(The future of osteopathy belongs to activity)
Levin, P.
Osteopathische Medizin, 2018/12
2414

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12
2415

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text
2416

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12
2417

Challenges and opportunities for Australian osteopathy: A qualitative study of the perceptions of registered osteopaths
Blaich, R., Steel, A., Clark, D., Adams, J.
International Journal of Osteopathic Medicine, 2018/12
2418

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text
2419

An overview of osteopathy graduates' perceived preparedness at transition from educational environment to clinic environment one year after graduation: a cross sectional study
Luciani, E., Consorti, G., van Dun, P. L. S., Merdy, O., Lunghi, C., Petracca, M., Esteves, J. E., Cerritelli, F.
BMC Medical Education, 2018/12
Free full text
2420

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text
2421

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text
2422

The importance of lymphatic osteopathic manipulative treatment (OMT) in the practice and training of osteopaths in Québec: A qualitative research study
Beaulieu-Provencher, S., Sylvain, H., Boisvert, Y.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2423

Can lateral epicondylitis be relief by osteopathic treatments targeting tensions from the thoracic region? Results of a case study
Brisson-Larouche, A., Kassab, G., Wehbe, W.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2424

Effect of global osteopathic treatment on functional mobility in the parkinsonian patient: A quasi-experimental study
Devantéry, K., Bouchard, J.C.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2425

The effect of early osteopathic manual treatment (OMT) care, after vaginal delivery, on pelvic health recovery
Fafard, A.M.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2426

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2427

Medical Humanities Teaching in North American Allopathic and Osteopathic Medical Schools
Klugman, C. M.
Journal of Medical Humanities, 2018/12
2428

Assessing the immediate behavioural responses of hospitalized preterm babies during osteopathic manipulative treatment (OMT): A case series
O'Connor, S., Lafrenaye, S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2429

Case study: Can craniosacral osteopathic manual treatment (OMT) decrease intensity and frequency of headaches in an adult with a past traumatic head injury associated with abducens nerve paralysis in childhood?
Piché, C., Charlebois, G., Beauchamp, O., Tétreault, N.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text
2430

The beliefs and attitudes of UK registered osteopaths towards chronic pain and the management of chronic pain sufferers - A cross-sectional questionnaire based survey
Macdonald, R. J. D., Vaucher, P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/12
Free full text
2431

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
2432

Immediate effect of T2, T5, T11 thoracic spine manipulation of asymptomatic patient on autonomic nervous system response: Single-blind, parallel-arm controlled-group experiment
Minarini, G., Ford, M., Esteves, J.
International Journal of Osteopathic Medicine, 2018/12
2433

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
2434

Osteopaticheskaia korrektsiia v kompleksnoi terapii i reabilitatsii patsientov s sindromom pozvonochnoi arterii.
[The use of the osteopathic correction for the combined treatment and rehabilitation of the patients presenting with the vertebral artery syndrome]
Belash, V. O., Mokhov, D. E., Tregubova, E. S.
Voprosy Kurortologii, Fizioterapii, i Lechebnoi Fizicheskoi Kultury, 2018/12
2435

Die Identität der Osteopathie in Deutschland – Spurensuche nach einem beruflichen Selbstverständnis
(The identity of osteopathy in Germany - Search for traces of a professional self-conception)
Ehmke, B.
Osteopathische Medizin, 2018/12
2436

Die Osteopathie nimmt noch nicht den ihr gebührenden Platz in der Welt der Medizin ein
(Osteopathy is not yet taking its appropriate place in the world of medicine. Interview with Renzo Molinari)
Engel-Schulmeyer, A.
Osteopathische Medizin, 2018/12
2437

First-year osteopathic students' use and perceptions of complementary video-based learning
Tripodi, N.
International Journal of Osteopathic Medicine, 2018/12
2438

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text
2439

Effect of Osteopathic Visceral Manipulation on Pain, Cervical Range of Motion, and Upper Trapezius Muscle Activity in Patients with Chronic Nonspecific Neck Pain and Functional Dyspepsia: A Randomized, Double-Blind, Placebo-Controlled Pilot Study
Silva, A. C. O., Biasotto-Gonzalez, D. A., Oliveira, F. H. M., Andrade, A. O., Gomes, Cafp, Lanza, F. C., Amorim, C. F., Politti, F.
Evidence-based Complementary and Alternative Medicine, 2018/11
Free full text
2440

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text
2441

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text
2442

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text
2443

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text
2444

The Émigré Physicians’ Experiences Before, While, and After Attending an American Osteopathic Medical School: A Cross-Sectional, Mixed Methods Study, Convergent Design
Burg, B. J., Goldstein, L., Sheflin, K., Jeger, A.
The Journal of the American Osteopathic Association, 2018/11
2445

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
The Journal of the American Osteopathic Association, 2018/11
2446

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
2447

Osteopathy and patients who have experienced sexual violence: management, treatment and self-care
Michael-Anna, E.
Unpublished MSc thesis, 2018/11
Free full text
2448

Clinically Based OMM Competency Standards for Physicians in Residencies Designated With Osteopathic Recognition in the Single Accreditation System for GME
Cooper Rau Jr., D., Merritt, M.
The Journal of the American Osteopathic Association, 2018/11
2449

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
2450

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11
2451

Regulatory and practice issues related to the acquisition of practical osteopathic skills for paediatric care
Evans, B.
Unpublished MSc thesis, 2018/11
Free full text
2452

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
2453

Using Team-Based Learning in Osteopathic Medical Education to Improve Understanding and Communication Regarding Chronic Diseases
Harp, E., Rutledge, A.
The Journal of the American Osteopathic Association, 2018/11
2454

Effects of Cranial Osteopathic Manipulative Medicine on Children With Plagiocephaly: Case Studies and Proposed Clinical Trial
King, H. H., Mai, J., Morelli, M. A., Centers, S., Sweeney, M.
The Journal of the American Osteopathic Association, 2018/11
2455

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
2456

Patient Perceptions of Osteopathic and Allopathic Physician Communication Style and Empathy and Reported Satisfaction with Low Back Care
Licciardone, J. C., Schmitt, M. E.
The Journal of the American Osteopathic Association, 2018/11
2457

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
The Journal of the American Osteopathic Association, 2018/11
2458

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
2459

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11
2460

Where Comfort and Confidence Diverge: Missed Opportunities for Sexual and Gender Minority Competency in Osteopathic Education
Rashid, H., Schenck-Smith, N., Weirich, E., Lenox, A., Sheikh, H., Boesler, D.
The Journal of the American Osteopathic Association, 2018/11
2461

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11
2462

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11
2463

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2464

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2465

Eficácia da manipulação visceral osteopática em pacientes com constipação funcional e dor lombar crônica inespecífica: ensaio clínico placebo-controlado aleatorizado
(Effectiveness of osteopathic visceral manipulation in patients with functional constipation and non-specific chronic low back pain: randomized placebo-controlled clinical trial)
Fernandes, W. V. B.
Unpublished PhD thesis, 2018/10
Free full text
2466

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text
2467

Kann die Schwangerschaftsrate nach technisch assistierter Reproduktion durch osteopathische Behandlungen erhöht werden?
(Can the pregnancy rate after assisted reproductive technology be increased through osteopathic treatments?)
Samouh, S.
Unpublished MSc thesis, 2018/10
Free full text
2468

An Osteopathic Approach to Diagnosis and Management of Sacroiliac Joint Dysfunction
Glover, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2469

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10
2470

Visceral manipulation to treat functional constipation in stroke survivors: A randomized, controlled, double-blind, clinical trial
Neto, H. P., Borges, R. A., Bicalho, E. S., Oliveira, C. S.
Journal of Bodywork and Movement Therapies, 2018/10
2471

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2472

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10
2473

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text
2474

Die osteopathische Behandlung aus PatientInnensicht – Interviews mit PatientInnen über ihre subjektive Befindlichkeit während osteopathischen Behandlungen
(The osteopathic treatment from the patient's point of view - Interviews with patients about their subjective well-being during osteopathic treatments)
Hocher, J.
Unpublished MSc thesis, 2018/10
Free full text
2475

Die Rolle der Eltern in der osteopathischen Säuglingsbehandlung innerhalb der ersten drei Lebensmonate aus Sicht von Eltern und OsteopathInnen
(The Role of the Parents in Osteopathic Care of Infants within the First Three Months of Life from the Parents’ and Practitioners’ Perspectives)
Bechinie, C.
Unpublished MSc thesis, 2018/10
Free full text
2476

Health literacy across all year levels of a cohort of Australian osteopathy students
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10
2477

Partners in Health (PIH) scale responses of musculoskeletal patients in a student clinic
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10
2478

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text
2479

(Effectiveness of osteopathic treatment in patients with chronic knee pain. A randomized controlled trial)
Weitendorff, A.
Unpublished D.O. thesis, 2018/10
2480

Osteopathic Evaluation of Urinary Retention Caused by Atypical Presentation of Invasive Cervical Cancer Mimicking Primary Urothelial Tumor
Martingano, D., Ramirez, L. C., Bjurlin, M. A.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2481

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text
2482

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
2483

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität und das Angstbefinden bei einer Patientin mit einer chronischen Lungensarkoidose.
(Possible success of an individualized osteopathic treatment regarding the quality of life and the state of anxiety of a patient with a chronic lung sarcoidosis)
Origer, S.
Unpublished MSc thesis, 2018/10
Free full text
2484

Validity of the Rule of Threes and Anatomical Relationships in the Thoracic Spine
Oakley, C. K., Janssen, S. A. K., Pankratz, J. P., McCumber, T. L., Treffer, K. D., Olinger, A. B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2485

Messung des Effekts einer Midline-Behandlung. Eine randomisierte kontrollierte Studie mit gesunden Erwachsenen.
(Measuring the effect of a midline treatment: randomized controlled trial in healthy adults)
Galoppi, M.
Unpublished MSc thesis, 2018/10
Free full text
2486

A Short Review of the Treatment of Headaches Using Osteopathic Manipulative Treatment
Whalen, J., Yao, S., Leder, A.
Current Pain and Headache Reports, 2018/10
2487

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text
2488

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text
2489

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text
2490

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
2491

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
2492

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text
2493

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
2494

Von A.T. Stills Theorie der osteopathischen Läsion zur somatischen Dysfunktion
(From A.T. Still's theory of the osteopathic lesion based on somatic dysfunction: Historical development and evidence-based models that support the current concept of somatic dysfunction)
Liem, T.
Osteopathische Medizin, 2018/09
2495

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09
2496

Behandlung einer Patientin mit Schulter-Arm-Syndrom nach proximaler Radiusfraktur infolge eines Sturzes
(Treatment of a patient with shoulder-arm syndrome after proximal radius fracture as a result of a fall: Commented case study on the article “Resonance and dialogue: On the methodology of a neuroregulative treatment model“)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/09
2497

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
2498

In welchem Ausmaß kann die Osteopathie bei Kindern mit Zerebralparese die Bewegung mit funktionellen Konsequenzen und die Lebensqualität positiv beeinflussen
(To what extend can osteopathy have a positive influence on movement with functional consequences and quality of life by children with cerebral palsy)
Schneider, D.
Unpublished MSc thesis, 2018/09
2499

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09
2500

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text
2501

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text
2502

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text
2503

Impact of the workforce distribution on the viability of the osteopathic profession in Australia: results from a national survey of registered osteopaths
Steel, A., Jackson, N., Blaich, R., Kirk, M., Wardle, J.
Chiropractic & Manual Therapies, 2018/09
Free full text
2504

Preparing Osteopathic Students for the Single Graduate Medical Education Accreditation System: Evaluating Factors for Match Success in Emergency Medicine
Stobart-Gallagher, M., O', Connell, A.
Western Journal of Emergency Medicine, 2018/09
Free full text
2505

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09
2506

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
2507

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
2508

Ernährungswissen: Integrativer Bestandteil der Osteopathie in Deutschland?
(Nutritional Knowledge: An integrative part of osteopathy in Germany?)
Nier, R.
Unpublished MSc thesis, 2018/09
Free full text
2509

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text
2510

Investigating practitioners' perceptions of the role of spirituality in osteopathic practice using Interpretative Phenomenological Analysis
Bacon, S. W., Roe, C. A.
International Journal of Osteopathic Medicine, 2018/09
2511

Die Ausübung der Gesundheitsfürsorge aus Patienten- und Therapeutensicht – eine Grounded-Theory-Analyse
(The health care practice from a patient's and practitioner's perspective - A grounded theory analysis)
Günther, F., Belz, S.
Osteopathische Medizin, 2018/09
2512

Der Osteopath – lebenslanges Lernen und Entwicklung
(The osteopath - lifelong learning and development)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
2513

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text
2514

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08
2515

Sleep and Lifestyle Habits of Osteopathic Emergency Medicine Residents During Training
Hughes, K. E., Hughes, P. G., Hughes, M. J.
The Journal of the American Osteopathic Association, 2018/08
Free full text
2516

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text
2517

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text
2518

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text
2519

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08
2520

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08
2521

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text
2522

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text
2523

Quantitative Description of Osteopathic Physician Authorship in Prominent Neurosurgery Journals Since 1944: Coming of Age?
Cuoco, J. A., Busch, C. M., Rogers, C. M., Guilliams, E. L., Klein, B. J., Howes, G. A., Marvin, E. A.
Cureus, 2018/08
Free full text
2524

Progressive Infantile Scoliosis Managed With Osteopathic Manipulative Treatment Response
Feely, R. A., Kapraun, H. E.
The Journal of the American Osteopathic Association, 2018/07
Free full text
2525

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text
2526

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text
2527

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text
2528

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
2529

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
2530

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07
2531

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text
2532

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07
2533

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07
2534

Enablers and barriers to the development of interprofessional collaboration between physicians and osteopaths: A mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
Journal of Interprofessional Care, 2018/07
2535

Burnout Rates in Oklahoma State University - College of Osteopathic Medicine Alumni
Chaffin, J.
Unpublished MSc thesis, 2018/07
Free full text
2536

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07
2537

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text
2538

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text
2539

Blood pressure screening in an Australian osteopathy student-led clinic
Vaughan, B., Cannon, N., Davies, D., Kourtis, N., Neophitou, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2018/06
2540

Osteopathic Evaluation and Post-Surgical Rehabilitation Approach in a Patient With Myelopathy and Tetraparesis Related to Cervical Ependymoma: A Case Report
Lewis, D. D.
The AAO Journal, 2018/06
Free full text
2541

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text
2542

The immediate effects of two manual therapy techniques on ankle musculoarticular stiffness and dorsiflexion range of motion in people with chronic ankle rigidity: A randomized clinical trial
Hidalgo, B., Hall, T., Berwart, M., Biernaux, E., Detrembleur, C.
Journal of Back and Musculoskeletal Rehabilitation, 2018/06
2543

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text
2544

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
2545

Osteopathic Cranial Manipulative Medicine in the Setting of Concussion
Warren, C., Keys, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/06
Free full text
2546

The attitudes and beliefs of UK osteopaths towards the management of low back pain: A cross-sectional study
Bar-Zaccay, A., Bailey, D.
International Journal of Osteopathic Medicine, 2018/06
2547

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06
2548

The Lancet Low Back pain series: A call to action for osteopathy?
Fitzgerald, K., Vaughan, B., Austin, P., Grace, S., Orchard, D., Orrock, P.l, Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/06
2549

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06
2550

The use of osteopathic manipulative medicine in the treatment of headaches for a patient with subdural hematomas in the setting of traumatic brain injury
Bonthala, S., Falco, C.
The Journal of Head Trauma Rehabilitation, 2018/06
2551

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06
2552

Barriers to identifying mood disorders in clients by New Zealand osteopaths: Findings of a thematic analysis
Kovanur Sampath, K., Roy, D. E.
International Journal of Osteopathic Medicine, 2018/06
2553

Musculoskeletal Education in Medical Schools: A Survey of Allopathic and Osteopathic Medical Students
Sabesan, V. J., Schrotenboer, A., Habeck, J., Lombardo, D., Stine, S., Jildeh, T. R., Meiyappan, A.
Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews, 2018/06
Free full text
2554

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06
2555

Anastamosis
Ackert, K.
The Journal of the American Osteopathic Association, 2018/06
Free full text
2556

Attitudes and self-reported practices of New Zealand osteopaths to exercise consultation
Mistry, R. A., Bacon, C. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2018/06
2557

Letter to the editor on Holism in Osteopathy - Bridging the gap between concept and practice: A grounded theory study
Morelli, R.
International Journal of Osteopathic Medicine, 2018/06
2558

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
2559

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text
2560

An exploration of osteopaths' views and experiences regarding the identification of, and provision of advice for, urinary incontinence in women: A qualitative study using framework analysis
Robinson, M. E., Ford, S. L., Goodman, L. B.
International Journal of Osteopathic Medicine, 2018/06
2561

Evidence, alternative facts and narrative: A personal reflection on person-centred care and the role of stories in healthcare
Tyreman, S.
International Journal of Osteopathic Medicine, 2018/06
Free full text
2562

Palpation - Eine Fähigkeit des Gehirns?
(Palpation: An ability of the brain?)
Krause, R.
Osteopathische Medizin, 2018/05
2563

Leistenschmerzen aus Sicht des Hernienchirurgen
(Inguinal pain from the point of view of the hernia surgeon)
Kuthe, A.
Osteopathische Medizin, 2018/05
2564

Review zur Bedeutung der Schädelbasis in der Osteopathie
(Review on the importance of the cranial base in osteopathy)
Liem, T.
Osteopathische Medizin, 2018/05
2565

Types of articles published in journals of osteopathy: a quantitative analisys from 2009 to 2013
Civitillo, C., Armeni, M., Leggio, M.
GIOSBE Journal, 2018/05
2566

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05
2567

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text
2568

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05
2569

Efficacy of Osteopathic Manipulative Treatment in the Patient of Chronic Rhinosinusitis: A Case Report
Baisakhiya, N.
An International Journal Clinical Rhinology, 2018/05
2570

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2571

A workforce survey of Australian osteopathy: analysis of a nationally-representative sample of osteopaths from the Osteopathy Research and Innovation Network (ORION) project
Adams, J., Sibbritt, D., Steel, A., Peng, W.
BMC Health Services Research, 2018/05
Free full text
2572

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2573

Osteopathic Manipulation Shown to Improve Upper Airway Stabilization
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2574

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2575

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text
2576

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05
2577

Exploring the measurement properties of the osteopathy clinical teaching questionnaire using Rasch analysis
Vaughan, B.
Chiropractic & Manual Therapies, 2018/05
Free full text
2578

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2579

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2580

Restoration of Full Shoulder Range of Motion After Application of the Fascial Distortion Model
Boucher, J. D., Figueroa, J.
The Journal of the American Osteopathic Association, 2018/05
Free full text
2581

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2582

Appendix 2: American Osteopathic Association Specialty Board Certification
Wieting, J. M., Williams, D. G., Kelly, K. A., Morales-Egizi, L.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2583

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04
2584

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04
2585

Chronic inflammatory exposure changes the phenotype of human skeletal muscle cells
McManus, C., Richardson, C.
FASEB Journal, 2018/04
2586

Educational avenues to promote fascia dialog in medical curricula
Pratt, R.
FASEB Journal, 2018/04
2587

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2588

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04
2589

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04
2590

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04
2591

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04
2592

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text
2593

IGeL-Monitor. Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text
2594

Complaints about chiropractors, osteopaths, and physiotherapists: A retrospective cohort study of health, performance, and conduct concerns
Ryan, A. T., Too, L. S., Bismark, M. M.
Chiropractic & Manual Therapies, 2018/04
Free full text
2595

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2596

An investigation of attitudes and underlying beliefs toward low back pain among osteopathy students using the Back Pain Attitudes Questionnaire (Back-PAQ)
Hilbink, H.
Unpublished MSc thesis, 2018/04
Free full text
2597

Effectiveness of 2 Osteopathic Treatment Approaches on Pain, Pressure-Pain Threshold, and Disease Severity in Patients with Fibromyalgia: A Randomized Controlled Trial
Albers, J., Jäkel, A., Wellmann, K., von Hehn, U., Schmidt, T.
Complementary medicine research, 2018/04
2598

Educational Intervention in a Medically Underserved Area
Atance, J., Mickalis, M., Kincade, B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2599

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2600

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text
2601

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2602

Behandlung der kranialen Abflüsse bei HWS-Problematik
(Treatment of cranial drains in cervical spine problems)
Hanke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2603

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2604

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03
2605

Einfluss der osteopathischen Therapie auf funktionelle Sehstörungen beim Schulkind
(Influence of osteopathic therapy on functional visual disorders in schoolchildren)
Nestel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
Free full text
2606

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text
2607

Wann braucht ein Kind Physiotherapie und wann Osteopathie?
(When does a child need physiotherapy and when do they need osteopathy?)
Schwahn, N., Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
2608

Osteopathic Manipulative Treatment in the Management of Pediatric Headache and Orthodontic Intervention: A Case Report
Heineman, K.
The AAO Journal, 2018/03
Free full text
2609

Characterizing Adverse Events Reported After Osteopathic Manipulative Treatment
Degenhardt, B. F., Johnson, J. C., Brooks, W. J., Norman, L.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2610

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2611

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03
2612

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2613

Einfluss der craniosacralen Behandlung CV-4 bei Schwangeren in der 41. Schwangerschafts-woche.
(The influence of craniosacral CV-4-treatment on pregnancies in the 41st week of pregnancy)
Samonigg-Lackner, D.
Unpublished MSc thesis, 2018/03
Free full text
2614

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2615

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2616

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2617

Der achtsame A.T. Still
(The mindful A.T. Still)
Schötta, M.
Unpublished MSc thesis, 2018/03
Free full text
2618

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2619

‘I just don't have the tools’ - Italian osteopaths' attitudes and beliefs about the management of patients with chronic pain: A qualitative study
Formica, A., Thomson, O. P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/03
Free full text
2620

“Der schiefe Kopf“ Befundungs- und Behandlungsprozess bei Säuglingen mit Plagiozephalie mittels Experteninterviews
(“The Oblique Head“ Follow-Up and Treatment Process for Infants with Orthesis by Interview of Experts)
Michaelis, C.
Unpublished MSc thesis, 2018/03
Free full text
2621

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text
2622

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text
2623

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
2624

Assessment of cervical stiffness in axial rotation among chronic neck pain patients: A trial in the framework of a non-manipulative osteopathic management
Dugailly, P. M., Coucke, A., Salem, W., Feipel, V.
Clinical Biomechanics, 2018/03
2625

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03
2626

Effektivität der osteopathischen Behandlung bei Patienten mit chronischem Knieschmerz, eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with chronic knee pain, a randomized controlled study)
Weitendorff, A.
Unpublished MSc thesis, 2018/03
2627

Pre-entry qualifications as predictors of success in first year osteopathic education
Palfreyman, S., Mercier, J., Friedlander, T.
International Journal of Osteopathic Medicine, 2018/03
2628

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
2629

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text
2630

Kann durch eine Serie von osteopathischen Behandlungen die Lebensqualität von Bewohnern eines Altenheims, die an Osteoporose erkrankt sind, mehr verbessert werden als mit einer alternativen Behandlung in Form von Bewegungstherapie?
(Can the quality of life of an elderly who is affected by osteoporosis be improved through a series of osteopathic treatments, rather than with an alternative treatment in the form of movement therapy?)
Preis, G.
Unpublished MSc thesis, 2018/03
Free full text
2631

Pilotstudie über den Einfluss der osteopathischen Behandlung des Mesenteriums auf das Atemvolumen
(Pilot study on the influence of the treatment of the mesentery on the respiratory volume)
Muigg, E.
Unpublished MSc thesis, 2018/03
Free full text
2632

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03
2633

Morphogenese
(Morphogenesis)
Leitner, M.
Unpublished MSc thesis, 2018/03
Free full text
2634

Core competencies in osteopathy: Italian register of osteopaths proposal
Sciomachen, P., Arienti, C., Bergna, A., Castagna, C., Consorti, G., Lotti, A., Lunghi, C., Tramontano, M., Longobardi, M.
International Journal of Osteopathic Medicine, 2018/03
Free full text
2635

Einfluss osteopathischer Behandlung bei Subacromialem Impingement-Syndrom (SAIS)
(Influence of Osteopathic Treatment on Subacromial Impingement Syndrome (SAIS))
Grill, H.
Unpublished MSc thesis, 2018/03
Free full text
2636

Osteopathie bei Rücken- und Beckengürtelschmerzen während und nach der Schwangerschaft
(Osteopathy in low back pain and pelvic girdle pain during and after pregnancy: Systematic review and meta-analysis)
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Osteopathische Medizin, 2018/03
2637

Mechanical Link – Protokoll für eine individuelle Diagnostik und Therapie
(Mechanical link - Protocol for an individual diagnostics and therapy)
Hafen-Bardella, C.
Osteopathische Medizin, 2018/03
2638

OMT to Address the Physiologic Effects of Stress
Emmet, D., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/02
Free full text
2639

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text
2640

Osteopathic Manipulative Treatment in Surgical Care: Short Review of Research Publications in Osteopathic Journals During the Period 1990 to 2017
Sposato, N. S., Bjersa, K.
Journal of Evidence-Based Integrative Medicine, 2018/02
Free full text
2641

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text
2642

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text
2643

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text
2644

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text
2645

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text
2646

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text
2647

Conceptualizing Addiction From an Osteopathic Perspective: Dopamine Homeostasis
Baron, D., Blum, K., Chen, A., Gold, M., Badgaiyan, R. D.
The Journal of the American Osteopathic Association, 2018/02
Free full text
2648

Einfluss postoperativer Adhäsionen nach Sektio auf chronischen Low Back Pain - eine Pilotstudie
(Influence of postoperative adhesion after caesarean section on chronic lower back pain - a pilot study)
Liedler, M.
Unpublished MSc thesis, 2018/02
Free full text
2649

Erhöht eine interne myofasciale osteopathische Technik am Beckenboden die Effektivität des Beckenbodentrainings bei Frauen mit Belastungsinkontinenz?
(Does an internal myofascial osteopathic technique applied on the pelvic floor muscles increase the efficiency of the pelvic floor muscle training on women with stress urinary incontinence?)
Hie-Wiederstein, M.
Unpublished MSc thesis, 2018/02
Free full text
2650

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
2651

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
2652

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2653

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
2654

Themes underlying Australian general practitioner views towards chiropractic and osteopathy: An assessment of free text data from a cross-sectional survey
Grace, S., Engel, R., Jalsion, I.
Evidence-based Complementary and Alternative Medicine, 2018/01
Free full text
2655

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2656

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2657

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2658

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2659

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork and Movement Therapies, 2018/01
2660

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2661

An evaluation of osteopathic treatment on psychological outcomes with patients suffering from chronic pain: A prospective observational cohort study collected through a health and well-being academy
Edwards, D. J., Toutt, C.
Health Psychology Open, 2018/01
Free full text
2662

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text
2663

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2664

OSTMED.DR(R), an Osteopathic Medicine Digital Library
Fitterling, L., Powers, E., Vardell, E.
Medical reference services quarterly, 2018/01
2665

Manual therapy for unsettled, distressed and excessively crying infants: a systematic review and meta-analyses
Carnes, D., Plunkett, A., Ellwood, J., Miles, C.
BMJ Open, 2018/01
Free full text
2666

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01
2667

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text
2668

Combined osteopathy and exercise management of Achilles tendinopathy in an athlete
Ross, G., Macfarlane, C., Vaughan, B.
The Journal of Sports Medicine and Physical Fitness, 2018/01
2669

Analysis of Factors that Influence Pre-med Undergraduate Selection of Osteopathic or Allopathic Medical School
Kuizin, L. A.
Unpublished Dissertation, 2018/01
2670

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2671

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2672

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text
2673

Safety of Osteopathic Cranial Manipulative Medicine as an Adjunct to Conventional Postconcussion Symptom Management: A Pilot Study
Patel, K. G., Sabini, R. C.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2674

OMT for Cancer Patients After Bowel Resection
Pena, N., Prieto, H., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
2675

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018
2676

Die Wirklichkeit der Osteopathie. Studie zu einer am Leib orientierten Anthropologie
(The reality of osteopathy. Study of an anthropology oriented to the lived body)
Kaiser, A.K.
Dissertation, 2018
2677

Neurobiology of Sexual Assault and Osteopathic Considerations for Trauma-Informed Care and Practice
Cuevas, K. M., Balbo, J., Duval, K., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2678

Tools zum Erlernen der Palpation
(Tools for learning palpation)
Krause, R.
Osteopathische Medizin, 2017/12
2679

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text
2680

A road to somewhere - endless debate about the nature of practice, the profession and how we should help patients
Vogel, S.
International Journal of Osteopathic Medicine, 2017/12
2681

Osteopathische Läsion – Teil 2: Definitionen und Terminologien
(Osteopathic lesion - Part 2: Definitions and terminologies)
Liem, T.
Osteopathische Medizin, 2017/12
2682

Kommentar des Autors
Author's comment
Liem, T.
Osteopathische Medizin, 2017/12
2683

Advancing the Understanding and Treatment of the Thoracic Inlet and Incorporation of a New Still Technique—Part 1
Lewis, D. D.
The AAO Journal, 2017/12
Free full text
2684

Compression of the Fourth Ventricle Using a Craniosacral Osteopathic Technique: A Systematic Review of the Clinical Evidence
Zurowska, A., Malak, R., Kolcz-Trzesicka, A., Samborski, W., Paprocka-Borowicz, M.
Evidence-based Complementary and Alternative Medicine, 2017/12
Free full text
2685

OMT for Patients With Multiple Sclerosis
Wolf, K., Krinard, T., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2686

Braucht es einen Paradigmenwechsel in der osteopathischen Diagnostik und Therapie im kraniozervikalen Bereich?
(Is a paradigm shift required in osteopathic diagnosis and treatment in the craniocervical junction?)
Moser, U.
Osteopathische Medizin, 2017/12
2687

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12
2688

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2689

Use of pressure dynamometer in the assessment of the pressure pain threshold in trigger points in the craniocervical muscles in women with unilateral migraine and tension-type headache: An observational study
Pires, R., da Rocha, N. S., Esteves, J. E., Rodrigues, M. E.
International Journal of Osteopathic Medicine, 2017/12
2690

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12
2691

Let's get physical!
Hickner, J.
The Journal of Family Practice, 2017/12
2692

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
2693

Osteopathic manipulative treatment for post mastectomy lymphedema: A case report
Goyal, M, Goyal, K, Narkeesh, K., Samuel, A. J., Arumugam, N.
International Journal of Osteopathic Medicine, 2017/12
2694

Osteopathic Manipulative Treatment for the Management of Adjacent Segment Pathology
Lewis, D. D., Summers, G. K.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2695

OSTEHOM, recurso educativo digital para la enseñanza y aprendizaje de la cintura escapular (Hombro) en Osteopatía Estructural
(OSTEHOM: Digital educational resource for teaching and learning about the shoulder girdle in Structural Osteopathy)
Arenas Romero, M. V.
Unpublished MSc thesis, 2017/12
Free full text
2696

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text
2697

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text
2698

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text
2699

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2700

Osteopathy and troublesome regurgitation in babies. The influence of a set of osteopathic techniques on the symptoms of troublesome regurgitation in babies. A randomized controlled clinical trial
Schepers, V.
Unpublished D.O. thesis, 2017/12
2701

When, why, and how osteopaths and physicians communicate: Lessons learned from the results of a mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
International Journal of Osteopathic Medicine, 2017/12
2702

Developing a new approach to persistent pain management in osteopathic practice. Stage 1: A feasibility study for a group course
Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/12
2703

Complementary and alternative therapies in dentistry and characteristics of dentists who recommend them
Baatsch, B., Zimmer, S., Rodrigues Recchia, D., Bussing, A.
Complementary Therapies in Medicine, 2017/12
2704

Median Arcuate Ligament Syndrome (MALS): Fallserie über die osteopathische Behandlung von sieben Patienten: Evidenzlevel IV gemäß CARE-Guideline
(Median arcuate ligament syndrome (MALS): Case series on the osteopathic treatment of seven patients. Evidence level IV according to CARE guidelines)
Beck, M.
Osteopathische Medizin, 2017/12
2705

‘Sometimes I don't feel like an osteopath at all’- a qualitative study of final year osteopathy students' professional identities
Clarkson, H. J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2017/12
2706

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
2707

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2708

Current Clinical Status of Osteopathy: Study Based on Retrospective Evidences of Six Years, A Systemic Review
Ahmad, R.
Annual Research & Review in Biology, 2017/11
Free full text
2709

Descriptive study of interprofessional collaboration between physicians and osteopaths for the pediatric population in Quebec, Canada
Morin, C., Desrosiers, J., Gaboury, I.
BMC Health Services Research, 2017/11
Free full text
2710

Correction: Does Visceral Osteopathic Treatment Accelerate Meconium Passage in Very Low Birth Weight Infants?- A Prospective Randomized Controlled Trial
Haiden, N., Pimpel, B., Kreissl, A., Jilma, B., Berger, A.
PLoS One, 2017/11
Free full text
2711

Functional Limitations in Adults Who Utilize Chiropractic or Osteopathic Manipulation in the United States: Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2017/11
2712

Comparing the Effect of Osteopathic Manipulative Medicine Versus Concussion Education for the Acute Treatment of Mild Concussion Symptoms
Angelo, N., Zwibel, H., Leder, A., Mancini, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
2713

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11
2714

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
2715

Engaging in “Mind, Body, Spirit”—A Student Perspective on Incorporating Mindfulness in Osteopathic Medical Education Through the Wellness, Academic, Resilience and Mindfulness (WARM) Curriculum
Hu, H., Khorsand, M., Anand, R., Hendriksz, T., Velasco, H. E.
The Journal of the American Osteopathic Association, 2017/11
2716

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
The Journal of the American Osteopathic Association, 2017/11
2717

Touro California Student-Run Free Clinic: An Investigation of Actual vs Target Patient Demographic and the Impact of Osteopathic Manipulative Medicine in the Vallejo, California, Community
Jamall, S., Ang, B., Kimpo, J. V., Liu, B., Donn, E., Szeto, H., Devanney, J., Pearce, M.
The Journal of the American Osteopathic Association, 2017/11
2718

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11
2719

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
The Journal of the American Osteopathic Association, 2017/11
2720

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11
2721

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2722

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text
2723

Evaluation of New Zealand osteopathy patients experiences of their treatment
Judkins, R., Vaughan, B., Mulcahy, J.
Complementary Therapies in Clinical Practice, 2017/11
2724

Effect of Osteopathic Cranial Manipulative Medicine on Visual Function
Bach, A., Bach, M., Frankel, S.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2725

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2726

Condylar Decompression Technique for Infants
Pierce-Talsma, S., Pena, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
2727

Vital Signs of U.S. Osteopathic Medical Residency Programs Pivoting to Single Accreditation Standards
Novak, T. S.
Unpublished PhD thesis, 2017/10
Free full text
2728

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text
2729

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text
2730

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text
2731

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text
2732

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10
2733

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text
2734

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text
2735

Manipulative scar treatment and ostheopatic manipulative treatment for pain, shoulder motion and quality of life in post-mastectomy pain syndrome (PMPS). A randomized clinical trial
Figini, D., Seghini, P., Bidin, L.
Annals of Oncology, 2017/10
2736

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10
2737

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text
2738

Besteht ein Zusammenhang zwischen dem Modus der Geburt und dem Auftreten osteopathischer Dysfunktionen? Prädiktorenstudie.
(Investigation of correlations between mode of delivery and present osteopathic dysfunctions. Predictor-Study)
Armann, J.
Unpublished D.O. thesis, 2017/10
2739

Kann die osteopathische Behandlung die Krankheitsaktivität bei Patienten mit rheumatoider Arthritis (RA) beeinflussen? Randomisierte kontrollierte Studie.
(The influence of osteopathic treatment in addition to the standard therapy on disease activity in patients with rheumatoid arthritis (RA). A randomized controlled trial)
Franzen, K., Ramscheidt, B.
Unpublished D.O. thesis, 2017/10
2740

Wirksamkeit einer ganzheitlichen osteopathischen Behandlung bei Menschen mit Depression und damit einhergehenden Schlafstörungen. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with depression and associated sleep disturbance. A pre-post study)
Gruber, J.
Unpublished D.O. thesis, 2017/10
2741

Einfluss einer osteopathischen Behandlung am Tag des errechneten Geburtstermins auf das Einsetzen einer physiologischen Geburt innerhalb eines 48-Stunden Zeitraums. Randomisierte kontrollierte Studie.
(The influence of an osteopathic treatment at due date on the onset of labor within a 48-hour period. A randomized controlled trial)
Huss, S., Klose, M., Patanchon, P.
Unpublished D.O. thesis, 2017/10
2742

Postpartale Beschwerden von Müttern nach einem Kaiserschnitt
(Postpartal complaints of mothers after Caesarean section)
Weiss, A.
Unpublished MSc thesis, 2017/10
2743

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10
2744

Untersuchung der Effektivität von osteopathischen Behandlungen zusätzlich zur Standardtherapie bei Jugendlichen mit unspezifischen Kreuzschmerzen. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in addition to standard therapy in adolescents with unspecific low lack pain (LBP). A randomized controlled trial)
Ringeisen, P.
Unpublished D.O. thesis, 2017/10
2745

Osteopathie bei gastroosophagealem Reflux mit Hiatushernie: Ein Fallbericht gemass der CARE-Leitlinie
(Osteopathic Treatment of Gastroesophageal Reflux Disease and Hiatal Hernia: A Case Report Following the CARE Guideline)
Rotter, G., Brinkhaus, B.
Complementary Medicine Research, 2017/10
Free full text
2746

Osteopathische Behandlung von Patienten mit Impingement-Syndrom der Schulter. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with shoulder outlet impingement. A pre-post study)
Tallo, F.
Unpublished D.O. thesis, 2017/10
2747

Developing an evidence base for osteopathic healthcare: an exploration of osteopathic healthcare to inform the design of an appropriate methodology to investigate its effectiveness
Orrock, P. J.
Unpublished PhD thesis, 2017/10
Free full text
2748

Diabetes mellitus in der Osteopathie- beachten, behandeln, betreuen. Ein systematisierter Review
(Diabetes mellitus in Osteopathy-consider,treat, care. A systematized review)
Bertl, D.
Unpublished MSc thesis, 2017/10
Free full text
2749

Die Pathophysiologie von postoperativen peritonealen Adhäsionen - Osteopathie als Behandlungsmöglichkeit?
(The pathophysiology of postoperative peritoneal adhesions - Osteopathy as a treatment option?)
Lackner, I.
Unpublished MSc thesis, 2017/10
Free full text
2750

Osteopathie und die Auswirkung auf den Trainingslevel der MFT Challenge Disc. Eine kontrollierte randomisierte klinische Pilotstudie an gesunden Personen.
(Osteopathy and its effect on the Training Level of the MFT Challenge Disc. A randomised controlled pilot study of healthy adults)
Moser-Dobaj, A.
Unpublished MSc thesis, 2017/10
Free full text
2751

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text
2752

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/
2753

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2754

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text
2755

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09
2756

Prozessorientierung in der Osteopathie: ein Ansatz jenseits des Strukturmodells
(Process orientation in osteopathy: An approach beyond the structural model)
Lederman, E.
Osteopathische Medizin, 2017/09
2757

Die biodynamische Behandlung bei einem Patienten mit Makuladegeneration
(Biodynamic treatment of a patient suffering from macular degeneration)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2758

Update zur Drainage des Gehirns und osteopathische Behandlungsansätze
Update on brain drainage and osteopathic treatment approaches
Liem, T.
Osteopathische Medizin, 2017/09
2759

Osteopathic Manipulative Treatment for Chronic Neck Pain, Headaches, and Referred Pain in a Patient With Myofascial Pain Syndrome: A Case Report
Lewis, D. D.
The AAO Journal, 2017/09
Free full text
2760

The Use of Osteopathic Manual Therapy and Rehabilitation for Subacromial Impingement Syndrome: A Case Report
Bennett, S., Macfarlane, C., Vaughan, B.
Explore (NY), 2017/09
2761

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2762

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2763

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2764

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2765

Acupuncture Meridian-Based Myofascial Release to Treat Knee Pain in Sinding-Larsen–Johansson Syndrome: A Case Report
Valvano, K. D., Sina, R. E.
The AAO Journal, 2017/09
Free full text
2766

Pennsylvania Otolaryngologists as a Model for the Implications of Practice Location of Osteopathic vs Allopathic Surgical Subspecialists
Griffith, S., Power, A., Strand, M.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2767

Interet clinique du traitement osteopathique chez les patientes ayant une endometriose colorectale : classification fondee sur les symptomes et la qualite de vie.
(Impact of osteopathic manipulative therapy in patient with deep colorectal endometriosis: A classification based on symptoms and quality of life)
Darai, C., Bendifallah, S., Foulot, H., Ballester, M., Chabbert-Buffet, N., Darai, E.
Gynecologie, Obstetrique, Fertilite & Senologie, 2017/09
2768

Osteopathic approach to treating a patient with congenital infantile torticollis reveals unusual presentation of absence of concomitant cranial base strain pattern: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/09
2769

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2770

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 1: The mechanisms
Fryer, G.
International Journal of Osteopathic Medicine, 2017/09
2771

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text
2772

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text
2773

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2774

Osteopathische Behandlung bei Coxarthrose
(Osteopathic Treatment of Patients with Coxarthrosis: A Randomised Controlled Trial)
Vögele, T.
Unpublished MSc thesis, 2017/09
Free full text
2775

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2776

Aus welchen Gründen und mit welchen Beschwerden kommen Mütter innerhalb 18 Monate post partum zum/zur Osteopathen/in und welche somatischen Dysfunktionen weisen sie auf?
(What are the reasons and complaints of mothers who consult an osteopath within 18 months postpartum, and which somatic dysfunctions do they have?)
Woitzik, K.
Unpublished MSc thesis, 2017/09
Free full text
2777

Bewusstseinszustand von Osteopathen während einer kranialen Behandlung
(State of consciousness of osteopaths during cranial treatment)
Köppl-Hiptmair, K.
Unpublished MSc thesis, 2017/09
Free full text
2778

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2779

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2780

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2781

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2782

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2783

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text
2784

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text
2785

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08
2786

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08
2787

Efficacité d'un traitement ostéopathique pour les problématiques biomécaniques de succion des nouveau-nés
(Efficacy of an osteopathic treatment for infants with biomechanical sucking dysfunctions)
Herzhaft-Le Roy, J.
Unpublished MSc thesis, 2017/08
Free full text
2788

Conservative management of a traumatic meniscal injury utilising osteopathy and exercise rehabilitation: A case report
Feehan, J., Macfarlane, C., Vaughan, B.
Complementary Therapies in Medicine, 2017/08
2789

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2790

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2791

Meeting ACGME Standards Under a Unified Accreditation System: Challenges for Osteopathic Graduate Medical Education Programs
Cummings, M.
Academic Medicine, 2017/07
Free full text
2792

Successful outcome of musculoskeletal injury leads to a reduction in chronic fatigue: A case report
Todd, C.
Journal of Bodywork and Movement Therapies, 2017/07
2793

Efficacy of Osteopathic Manipulative Treatment Approach in the Patient with Pulmonary Fibrosis in Critical Care Outpatient Department
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Arumugam, N., Chatterjee, S., Sharma, S.
Indian Journal of Critical Care Medicine, 2017/07
Free full text
2794

The effectiveness of osteopathic manipulative treatment in an abnormal uterine bleeding related pain and health related quality of life (HR-QoL) - A case report
Goyal, K., Goyal, M., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S., Arumugam, N.
Journal of Bodywork and Movement Therapies, 2017/07
2795

Hypnosis and Osteopathic Manipulative Treatment for Visual Disorders During Pregnancy: A Case Report
Russo, G., Remonato, A., Remonato, R., Zanier, E.
Advances in Mind-Body Medicine, 2017/07
2796

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07
2797

Osteopathic approach to treating a patient with new onset low back pain following injury reveals unusual presentation of bilateral and symmetric symptoms: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/07
2798

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text
2799

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2800

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2801

Osteopathic Approach to Anxiety
Blumer, T.., Blumer, J.
Osteopathic Family Physician, 2017/07
Free full text
2802

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text
2803

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2804

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2805

Effects of Osteopathic Manipulative Therapy on Pain and Mood Disorders in Patients With High-Frequency Migraine
D'Ippolito, M., Tramontano, M., Buzzi, M. G.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2806

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06
2807

Osteopathie als aktuelle Satzungsleistung gesetzlicher Krankenkassen
(Osteopathy as current optional benefit of statutory health insurance companies)
Newiger, C.
Osteopathische Medizin, 2017/06
2808

Balanced Fascial Tension (BFT) am Beispiel der faszialen Hüllen des Herzens
(Balanced Fascial Tension (BFT) using the fascial sheaths of the heart as an example)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2809

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06
2810

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06
2811

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic literature review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2812

Diaphragm postural function in injured subtalar joint
Urbaniak, M., Kisilewicz, A., Klich, S.
Physiotherapy Quarterly, 2017/06
2813

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2814

Use of the Fascial Distortion Model to Evaluate a Limp in a Child
James, S. J., Hudnall, J.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2815

Mikrobiom: Worauf Sie bei Ihren Patienten achten sollten
(Microbiome: What you should pay particular attention to in your patients)
Zschocke, A. K.
Osteopathische Medizin, 2017/06
2816

Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment
Licciardone, J. C.
Musculoskeletal Science and Practice, 2017/06
2817

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06
2818

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2819

Difference in R01 Grant Funding Among Osteopathic and Allopathic Emergency Physicians over the Last Decade
Antony, M., Savino, J., Ashurst, J.
Western Journal of Emergency Medicine, 2017/06
Free full text
2820

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
2821

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
2822

Video explicativo para la enseñanza y aprendizaje de los fundamentos de la osteopatía ¿ Qué es la osteopatía?
(Explanatory video for teaching and learning the basics of osteopathy - What is osteopathy?)
Moreno Rojas, E. M.
Unpublished MSc thesis, 2017/06
Free full text
2823

Osteopathische Behandlungen nach Karpaltunneloperation – eine randomisierte kontrollierte Studie
(Osteopathic treatments after carpal tunnel surgery - A randomized controlled trial)
Deutschmann, G., Porthun, J., Grabner, O., Leskowschek, H., Graff, W., Sammer, A., Safran, T.
Osteopathische Medizin, 2017/06
2824

‘Talking a different language’: a qualitative study of chronic low back pain patients' interpretation of the language used by student osteopaths
Thomson, O. P., Collyer, K.
International Journal of Osteopathic Medicine, 2017/06
2825

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2826

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06
2827

(Explanatory video for teaching and learning the basics of osteopathy - What is osteopathy?)
Video explicativo para la enseñanza y aprendizaje de los fundamentos de la osteopatía ¿ Qué es la osteopatía?
Moreno Rojas, E. M.
Unpublished MSc thesis, 2017/06
Free full text
2828

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text
2829

The effect of visceral osteopathic manual therapy applications on pain, quality of life and function in patients with chronic nonspecific low back pain
Tamer, S., Öz, M., Ülger, O.
Journal of Back and Musculoskeletal Rehabilitation, 2017/05
2830

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05
2831

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2832

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2833

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2834

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text
2835

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2836

Effects of Osteopathic Treatment on Postural Equilibrium Evaluated through a Stabilometric Platform: A Randomized and Controlled Study
Buscemi, A., Cannatella, M., Lutrario, P., Rapisarda, A., Di Gregorio, G., Coco, M.
Journal of Functional Morphology and Kinesiology, 2017/05
Free full text
2837

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 2: Clinical approach
Fryer, G.
International Journal of Osteopathic Medicine, 2017/05
2838

Osteopathic Manipulative Treatment During the Third Trimester of Pregnancy
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2839

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2840

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text
2841

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text
2842

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2843

A efetividade do tratamento osteopático na constipação intestinal: uma revisão sistemática
(Effectiveness of the ostheopatic treatment in intestinal constipation: A systematic review)
Rocha Do Vale, J., De Carvalho, H. F. B., Andrade, V. L. Â, Almeida, L. C.
GED - Gastrenterologia Endoscopia Digestiva, 2017/04
2844

Autismus-Spektrum-Störung (ASS) und Osteopathie
(Autism spectrum disorder (ASD) and osteopathy)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2845

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2846

„Point of Balance“ in der osteopathischen Behandlung eines Kindes mit Handicap
(“Point of Balance“ in the osteopathic treatment of a child with handicap)
Müller, H.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2847

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2848

Preliminary evidence of Regional Interdependent Inhibition, using a 'Diaphragm Release' to specifically induce an immediate hypoalgesic effect in the cervical spine
McCoss, C. A., Johnston, R., Edwards, D. J., Millward, C.
Journal of Bodywork and Movement Therapies, 2017/04
2849

Im Gespräch mit … Angela Schleupen und Karl Heinz Riedl
(In dialog Angela Schleupen and Karl Heinz Riedl)
Schleupen, A., Riedl, K. H.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2850

Biological effects of direct and indirect manipulation of the fascial system. Narrative review
Parravicini, G., Bergna, A.
Journal of Bodywork and Movement Therapies, 2017/04
2851

Ein Leben mit Arthrogryposis multiplex congenita (ACM)
(Living with arthrogryposis multiplex congenita (AMC))
Seger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2852

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2853

Eine osteopathische Herangehensweise an reflexives Schreiben
(An osteopathic approach to reflective writing)
Brown, A., Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2854

Osteopathie bei infantiler Zerebralparese (IZP) – eine Einzelfallstudie
(Osteopathy in infantile cerebral palsy (IZP) - a single case study)
Budroni, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2855

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2856

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2857

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2858

Das Fasziendistorsionsmodell: Ein medizinisches Konzept – Praxiswissen kompakt
(The fascial distortion model: A medical concept - Praxiswissen Kompakt)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2859

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
2860

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2861

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text
2862

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text
2863

Collaboration interprofessionnelle entre médecins et ostéopathes impliqués auprès de la clientèle pédiatrique au Québec
(Interprofessional collaboration between physicians and osteopaths involved with pediatric population in Quebec)
Morin, C.
Unpublished PhD thesis, 2017/03
Free full text
2864

Osteopathic Manipulative Treatment for Nausea and Vomiting Following Fine Needle Aspiration of the Neck
Hess, N. J.
The AAO Journal, 2017/03
Free full text
2865

Dermascope Use by Osteopathic Primary Care Physicians
Morris, J. B., Alfonso, S. V., Hernandez, N., Fernández, M. I.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2866

Imaging Evidence Demonstrating Effectiveness of Osteopathic Visceral Manipulation Techniques in Treating Pseudo-Obstruction
Ignatowicz, A., Berkowitz, M. R.
The AAO Journal, 2017/03
Free full text
2867

Osteopathic Manipulative Treatment in the Management of Isaacs Syndrome
Shanahan, L. K. T., Raines, S. G., Coggins, R. L., Moore, T., Carnes, M., Griffin, L.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2868

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2869

Efficacy of Myofascial Unwinding and Myofascial Release Technique in a Patient with Somatic Symptoms - A Case Report
Goyal, M., Goyal, K., Bathla, M., Kanimozhi, D., Narkeesh, D.
Indian journal of Psychological Medicine, 2017/03
Free full text
2870

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03
2871

A mixed methods evaluation of a third wave cognitive behavioural therapy and osteopathic treatment programme for chronic pain in primary care (OsteoMAP)
Carnes, D., Mars, T., Plunkett, A., Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/03
2872

A critical review of manual therapy use for headache disorders: prevalence, profiles, motivations, communication and self-reported effectiveness
Moore, C. S., Sibbritt, D. W., Adams, J.
BMC Neurology, 2017/03
Free full text
2873

Osteopathic manipulative treatment showed reduction of length of stay and costs in preterm infants: A systematic review and meta-analysis
Lanaro, D., Ruffini, N., Manzotti, A., Lista, G.
Medicine (Baltimore), 2017/03
Free full text
2874

Rehabilitation treatment for chronic lower back pain: New evidence for old methods? A randomized, controlled experimental trial
Rigoni, S., Scapin, M.
Minerva Ortopedica e Traumatologica, 2017/03
2875

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text
2876

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03
2877

Osteopathic manipulation as a complementary approach to Parkinson's disease: A controlled pilot study
Difrancisco-Donoghue, J., Apoznanski, T., De Vries, K., Jung, M. K., Mancini, J., Yao, S.
NeuroRehabilitation, 2017/03
2878

The risk associated with spinal manipulation: an overview of reviews
Nielsen, S. M., Tarp, S., Christensen, R., Bliddal, H., Klokker, L., Henriksen, M.
Systematic Reviews, 2017/03
Free full text
2879

Response to the Editorial “The enigmatic case of cranial osteopathy: Evidence vs clinical practice”
Monro, M., Farwell, S., Downes, W., Wilson, M., Carter, P. V.l, Douglas-Mort, D., Möckel, E., Zwierzchowska, Z., Apeztegia, J.
International Journal of Osteopathic Medicine, 2017/03
2880

Effects of a short-term osteopathic intervention on vertical jump and reach height in female recreational overhead athletes : a cross-over design
Green, T. C.
Unpublished MSc thesis, 2017/03
Free full text
2881

J Martin Littlejohn (1865–1947) and James Buchan Littlejohn (1868–1947): Two distinct directions – Osteopathy and the birth of osteopathic medicine
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2017/03
2882

Achtsamkeit und ihre Relevanz in der osteopathischen Praxis
(Mindfulness and its relevance to osteopathic practice)
Andrejcic, I.
Unpublished MSc thesis, 2017/03
Free full text
2883

Resilienz – Wie viel Stehaufmännchen steckt in den in Österreich arbeitenden OsteopathInnen?
(Resilience – How much stress can Austrian Osteopaths handle?)
Herz, K.
Unpublished MSc thesis, 2017/03
Free full text
2884

Osteopathie bei Schlafstörungen von Erwachsenen
(Osteopathic treatment on adults with sleep disturbances)
Litzlbauer, T.
Unpublished MSc thesis, 2017/03
Free full text
2885

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2886

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2887

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2888

Osteopathic treatment in a patient with left-ventricular assist device with left brachialgia: a case report
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Medical Case Reports Journal, 2017/02
Free full text
2889

Vom Aufhängeband zum Organ: neue Forschungsergebnisse zum Mesenterium
From the suspensory ligament to the organ: New findings on the mesentery
Plathner, M.
Osteopathische Medizin, 2017/02
2890

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
2891

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02
2892

Quiet dissent: The attitudes, beliefs and behaviours of UK osteopaths who reject low back pain guidance - A qualitative study
Figg-Latham, J., Rajendran, D.
Musculoskeletal Science and Practice, 2017/02
2893

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02
2894

The strain - Counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text
2895

JAOA Peer Reviewers, 2016
listed, No authors
The Journal of the American Osteopathic Association, 2017/02
Free full text
2896

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2897

Do you hear me?: the caregivers' experience of osteopathy for their child’s otitis media
McCulloch, J.
Unpublished MSc thesis, 2017/02
Free full text
2898

Somatic Dysfunction in the Diagnosis of Uncommon Ectopic Pregnancies: Surgical Correlation and Comparison With Related Pathologic Findings
Martingano, D., Canepa, H., Fararooy, S., Rybitskiy, D., Shahem, S., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2899

Osteopathische Behandlung chronischer unspezifischer Nackenschmerzen
(Osteopathic treatment of chronic nonspecific neck pain)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2017/02
2900

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/
2901

Developing an integrated osteopathy and acceptance-informed pain management course for patients with persistent pain
Abbey, H. A.
Unpublished PhD thesis, 2017/01
Free full text
2902

Im Gespräch mit … Sandra Bartu
(In dialog with Sandra Bartu)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2903

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text
2904

Die venöse Sinustechnik – Drainage der venösen Blutleiter
(The venous sinus technique - drainage of venous blood vessels)
Percival, H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2905

Évaluation de l’efficacité d’un traitement ostéopathique structurel chez des patients atteints de céphalées de tension
(Evaluation of the efficacy of structural osteopathic treatment in patients with tension-type headache)
Hug, A.
Unpublished MSc thesis, 2017/01
2906

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text
2907

CranioSacral Therapy and Visceral Manipulation: A New Treatment Intervention for Concussion Recovery
Wetzler, G., Roland, M., Fryer-Dietz, S., Dettmann-Ahern, D.
Medical Acupuncture, 2017/01
Free full text
2908

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text
2909

Osteopathic Manipulative Treatment Limits Chronic Constipation in a Child with Pitt-Hopkins Syndrome
Aquino, A., Perini, M., Cosmai, S., Zanon, S., Pisa, V., Castagna, C., Uberti, S.
Case Reports in Pediatrics, 2017/01
Free full text
2910

Integration of osteopathic manual treatments in management of cervical dystonia with tremor: A case series
Halimi, M., Leder, A., Mancini, J. D.
Tremor and Other Hyperkinetic Movements, 2017/01
Free full text
2911

Interprofessional Oral Health Education Improves Knowledge, Confidence, and Practice for Pediatric Healthcare Providers
Cooper, D.
Unpublished MSc thesis, 2017/01
Free full text
2912

Osteopathie und Psyche
(Osteopathy and Psyche)
Tschinkel, M.
Unpublished MSc thesis, 2017/01
Free full text
2913

The role of gentle touch in perinatal osteopathic manual therapy
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Neuroscience and Biobehavioral Reviews, 2017/01
2914

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text
2915

The role of New Zealand osteopaths in the care of people who experience migraine: a qualitative exploration
Chaise, K.
Unpublished MSc thesis, 2017/01
Free full text
2916

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text
2917

Osteopathische Behandlung eines Descensus genitalis und dessen Begleitsymptome bei Frauen. Eine Vergleichsstudie von Osteopathie und Elektrostimulation/Biofeedback für den Beckenboden
(Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative study of osteopathy and electrostimulation / biofeedback for pelvic floor)
Bogner, D.
Unpublished MSc thesis, 2017/01
Free full text
2918

Der kurzfristige Effekt des General Osteopathic Treatment auf die Beweglichkeit bei jungen Frauen am Beispiel “Finger-Boden-Abstand“. Eine quasi randomisierte, einfach verblindete, experimentelle Studie
(The short-term effect of General Osteopathic Treatment (GOT) on the mobility of young women using the Finger-Floor-Distance test (FFD). A quasi-randomized, single blinded, experimental study)
Dutzler, R.
Unpublished MSc thesis, 2017/01
Free full text
2919

Effectiveness of Osteopathic Therapy in the Treatment of Oral Submucous Fibrosis
Goyal, M., Aggarwal, A., Goyal, K., Garg, P.
Contemporary Clinical Dentistry, 2017/01
Free full text
2920

Effektivität von Osteopathie bei Patienten mit Migräne - ein Systematic Review
(The Effectiveness of Osteopathy in Treating Patients Suffering from Migraine - a Systematic Review)
Michlits-Lichtenecker, D.
Unpublished MSc thesis, 2017/01
Free full text
2921

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2922

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2923

Der osteopathische Ansatz beim allergischen Patienten
(The osteopathic approach to allergic patients)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2924

How Osteopathy Could Help Obstetrics in Diagnosis and Therapy. Preliminary Report About Safety and Efficacy of Osteopathy in an Obstetrics Department in Italy
Siccardi, M., Valle, C., Di Matteo, F., Perlo, B., Pratticò, M., Angius, V., Bianco, G., Damonte, V., Giusto, S., Palezzato, E., Tabò, M., Brichetto, C., Valle, P., Zolezzi, A., Parodi, G., Airaudi, G.
Journal of Perinatal Medicine, 2017/01
2925

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text
2926

Osteopathische Behandlung des Reizdarmsyndroms – ein Review
(Osteopathic treatment of irritable bowel syndrome - A review)
Krüger, S.
Osteopathische Medizin, 2016/12
2927

A Review of Hypertension and Its Management by Osteopathic Manipulative Therapy
Miller, A. D.
The AAO Journal, 2016/12
2928

Assessment of Hospital Staff's Knowledge of Osteopathic Manipulative Medicine: A Survey-Based Study
Smith-Kelly, J. B., Cardenas, A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2929

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text
2930

What can osteopaths learn from concerns and complaints raised against them? A review of insurance and regulator reports
Carnes, D.
International Journal of Osteopathic Medicine, 2016/12
2931

Säuglinge mit frühkindlicher Regulationsstörung – eine Pilotstudie
(Infants with early childhood regulation disorder - A pilot study)
Wikus, P.
Osteopathische Medizin, 2016/12
2932

A snap-shot of attrition from the osteopathy profession in Australia
Fitzgerald, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/12
2933

Reliability of Diagnosis and Clinical Efficacy of Cranial Osteopathy: A Systematic Review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
PLoS One, 2016/12
Free full text
2934

Somatic dysfunction: An osteopathic conundrum
Fryer, G.
International Journal of Osteopathic Medicine, 2016/12
2935

A Survey of Disaster Medical Education in Osteopathic Medical School Curricula
Parrillo, S. J., Christensen, D., Teitelbaum, H. S., Glassman, E. S.
Prehospital and Disaster Medicine, 2016/12
Free full text
2936

Efficacy of an Osteopathic Treatment Coupled With Lactation Consultations for Infants' Biomechanical Sucking Difficulties
Herzhaft-Le Roy, J., Xhignesse, M., Gaboury, I.
Journal of Human Lactation, 2016/12
2937

Osteopathic Manipulative Treatment for Somatic Dysfunction After Acute Severe Traumatic Brain Injury
McCallister, A., Brown, C., Smith, M., Ettlinger, H., Baltazar, G. A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2938

Effects of osteopathic manipulative treatment on hand function, disease symptoms and functional status in systemic sclerosis: a series of single-case studies in working women
O'Connor, S., Durand, M. J., Hudson, M., Baron, M., Gaudreault, N.
International Journal of Osteopathic Medicine, 2016/12
2939

Construção da Identidade profissional do osteopata
(Building the osteopath's professional identity)
Sousa, L. F. G.
Unpublished MSc thesis, 2016/12
Free full text
2940

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12
2941

Holism in Osteopathy – Bridging the gap between concept and practice: A grounded theory study
Turner, P. W. D., Holroyd, E.
International Journal of Osteopathic Medicine, 2016/12
2942

Alternative Scheduling Models: Improving Continuity of Care, Medical Outcomes, and Graduate Medical Education in Resident Ambulatory Training
Hussain, A. J.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2943

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2944

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2945

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text
2946

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2947

The Predictive Validity of the National Board of Osteopathic Medical Examiners' COMLEX-USA Examinations With Regard to Outcomes on American Board of Family Medicine Examinations
O'Neill, T. R., Peabody, M. R., Song, H.
Academic Medicine, 2016/11
Free full text
2948

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: The PROMOTE Study Protocol
Hensel, K. L., Carnes, M. S., Stoll, S. T.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2949

PROMOTE Study: Safety of Osteopathic Manipulative Treatment During the Third Trimester by Labor and Delivery Outcomes
Hensel, K. L., Roane, B. M., Chaphekar, A. V., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2950

Effects of osteopathic treatment on pulmonary function and chronic thoracic pain after coronary artery bypass graft surgery (OstinCaRe): study protocol for a randomised controlled trial
Roncada, G.
BMC Complementary and Alternative Medicine, 2016/11
Free full text
2951

Vergleich der Effektivität einer osteopathischen mit einer ausschließlich craniosacralen Therapie bei Temporomandibulärer Dysfunktion – eine Pilotstudie
(Comparison of the effectiveness of osteopathic versus craniosacral treatment for temporomandibular dysfunction - a pilot study.)
Gesslbauer, C., Keilani, M., Nicolakis, P., Mickel, M., Vavti, N., Crevenna, R.
Physikalische Medizin, Rehabilitationsmedizin, Kurortmedizin, 2016/11
2952

Das Potential osteopathisch manipulativer Therapie Myofibroblastenaktivität zu beeinflussen
(The potential of osteopathic manipulative therapy in regulating myofibroblast activity)
Hofbauer, A.
Unpublished MSc thesis, 2016/11
Free full text
2953

How do the Number and the Duration Between Osteopathic Treatments Influence the Effect on Patients Suffering from Foot-Related Pain? A Dose-Response Study
Kaufmann, J., Larsen, S.
International Journal of Pharma and Bio Sciences, 2016/11
Free full text
2954

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2955

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2956

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10
2957

Using Patient Perspective Sessions to Increase Empathy and Recall in Preclinical Medical Students
Hendriksz, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2958

The biomechanical model in manual therapy: Is there an ongoing crisis or just the need to revise the underlying concept and application?
Lunghi, C., Tozzi, P., Fusco, G.
Journal of Bodywork and Movement Therapies, 2016/10
2959

Multimodal compared to pharmacologic treatments for chronic tension-type headache in adolescents
Przekop, P., Przekop, A., Haviland, M. G.
Journal of Bodywork and Movement Therapies, 2016/10
2960

Osteopathic manipulative treatment in neurological diseases: Systematic review of the literature
Cerritelli, F., Ruffini, N., Lacorte, E., Vanacore, N.
Journal of the Neurological Sciences, 2016/10
2961

Manual therapy and OMT may be of benefit in the management of somatosensory tinnitus
King, H. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2962

A craniosacral osteopathic approach can help improve olfactory function in patient with a diminished sense of smell following head trauma
Barrette, M., Legault, K., Pomerleau, N., Ricard, M.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2963

Can postural manual osteopathic intervention improve temporo-mandibular joint (TMJ) opening in a client with scoliosis?
Bétournay, M., Desgagnes, A., Tran-Nguyen, B.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2964

Is cranial mobility affecting school performance and can osteopathic manual treatment (OMT) improve it? Results from a pilot study with children in a regular elementary curriculum
Bouchard, A.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2965

Can manual osteopathic techniques performed on the small and large intestines reduce the symptoms associated with irritable bowel syndrome?
Choquette, J., Plante, S., Sabourin, D.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2966

Efficacy of an osteopathic treatment for biomechanical suckling dysfunctions in newborn: A randomised controlled trial
Herzhaft-LeRoy, J., Gaboury, I., Xhignesse, M.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2967

The osteopath, an indispensable collaborator in a combined case study of orthodontics and orthognathic surgery
Hue, I.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2968

Development of trust between conventional and CAM practitioners: Insights from physicians and osteopaths in Quebec
Morin, C., Gaboury, I., Desrosiers, J.
Journal of Complementary and Integrative Medicine, 2016/10
Free full text
2969

Osteopathie als zusätzliche Therapie bei Kindern mit akuten Lungenentzündungen in Kambodscha. - Eine randomisiert-kontrollierte Pilotstudie.
(Osteopathic Manipulative Therapy as Adjunctive Treatment on Hospitalized Children with Pneumonia in Cambodia. - A randomized-controlled Pilotstudy)
Orsini-Rosenberg, T.
Unpublished MSc thesis, 2016/10
Free full text
2970

A.T. Still’s osteopathic lesion theory and evidence-based models supporting the emerged concept of somatic dysfunction
Liem, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2971

The effects of osteopathic treatment on snapping hip syndrome in ballet and contemporary dancers: A longtudinal study
Ryder, C.
Journal of Complementary and Integrative Medicine, 2016/10
2972

Manual Therapy in the Treatment of Idiopathic Scoliosis. Analysis of Current Knowledge
Czaprowski, D.
Ortopedia, Traumatologia, Rehabilitacja, 2016/10
Free full text
2973

Die osteopathische Behandlung von Kindern mit idiopathischer Säuglingsasymmetrie im Vergleich zur physiotherapeutischen Behandlung. Randomisierte kontrollierte Studie.
(Osteopathic treatment compared to physiotherapy in infants with idiopathic postural asymmetry. A randomized controlled trial)
Lange, T., Kramer, U., Hasemann, B.
Unpublished D.O. thesis, 2016/10
2974

Untersuchung der Effektivität der osteopathischen Behandlung bei Patienten mit Hypercholesterinämie mit mäßig erhöhten Gesamtcholesterinwerten. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in patients with moderate hypercholesterolemia. A randomized controlled trial)
Liedl, T., Pinter, K.
Unpublished D.O. thesis, 2016/10
2975

Osteopathische Behandlung von Patienten mit gastroösophagealer Refluxkrankheit (GÖR) additiv zur medikamentösen Standardtherapie. Randomisierte kontrollierte Studie.
(Osteopathic treatment in addition to usual care in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial)
Lynen, A., Schömitz, M., Vahle, M.
Unpublished D.O. thesis, 2016/10
2976

Die Entwicklung des Verständnisses von „Palpation“ in der historischen osteopathischen Literatur von A.T. Still, W.G. Sutherland und R. Becker. Literaturstudie.
(Development of understanding of “palpation” in historical osteopathic literature from A.T. Still, W.G. Sutherland and R. Becker. Literature review)
Sibbing, D.
Unpublished D.O. thesis, 2016/10
2977

Current clinical practices, experiences, and perspectives of healthcare practitioners who attend to dysfunctional breathing: A qualitative study
Shaw, J.
Unpublished MSc thesis, 2016/10
Free full text
2978

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2979

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2980

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2981

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text
2982

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09
2983

Osteopathische Imagination – ein Weg zur osteopathischen Selbstbehandlung
(Osteopathic Imagination - A way to osteopathic self-treatment)
Liedtke, H.
Osteopathische Medizin, 2016/09
2984

The enigmatic case of cranial osteopathy: Evidence versus clinical practice
Zegarra-Parodi, R., Cerritelli, F.
International Journal of Osteopathic Medicine, 2016/09
Free full text
2985

Die Regio inguinalis dextra aus osteopathischer Sicht
(The regio inguinalis dextra from an osteopathic point of view)
Kuschel, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2986

Spine Tango registry data collection in a conservative spinal service: a feasibility study
Morris, S., Booth, J., Hegarty, J.
European Spine Journal, 2016/09
2987

Nachruf auf Roger Seider
(Obituary for Roger Seider)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2988

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09
2989

Lumbalgie bei Uterusdeszensus
(Low back pain in uterine descent)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2990

Osteopathic Manipulative Therapy for Preterm Infants, Acupuncture for Menopausal Symptoms, Mindfulness-Based Stress Reduction for Chronic Low Back Pain, Chocolate for Ischemic Heart Disease, Berberine for Irritable Bowel Syndrome
Pettit, J., Glickman-Simon, R.
Explore (NY), 2016/09
2991

Die viszeralen Behandlungen des Andrew Taylor Still
(The visceral treatments of Andrew Taylor Still)
Marx, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2992

Osteopathie in Österreich – rechtliche Grundlage und Ausblick
(Osteopathy in Austria - Legal basis and outlook)
Mitschka, M., Wikus, P.
Osteopathische Medizin, 2016/09
2993

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2994

The Incidence of Somatic Dysfunction in Patients with Sudden Onset Atraumatic Neck Pain: A Retrospective Case Note Study
Snider, K. T., Ghouse, A., He, S. S., Pazdernik, V. K.
The AAO Journal, 2016/09
2995

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09
2996

Berufsgesetz Osteopathie
(Occupational law for osteopathy)
Newiger, C.
Osteopathische Medizin, 2016/09
2997

Integrative Behandlung der Nebennieren in der Osteopathie
(Integrative treatment of the adrenal glands in osteopathy)
Namer, V., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2998

Neurovaskuläre Mobilisation des Plexus hypogastricus inferior
(Neurovascular mobilization of the inferior hypogastric plexus)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2016/09
2999

Neue Ansätze für die Behandlung viszeraler Strukturen über den Schädel
(New approaches for the treatment of visceral structures via the skull)
Riedel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
3000

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09
3001

Preliminary development of a complex intervention for osteopathic management of dysfunctional breathing
Benjamin, J. G., Bacon, C. J., Verhoeff, W. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/09
3002

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09
3003

Einfluss osteopathischer Techniken auf das Lymph- und Immunsystem – eine systematische Übersichtsarbeit
(Influence of osteopathic techniques on the lymphatic and immune system - a systematic review)
Unger, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
3004

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09
3005

Behandlung der viszeralen Gefäße aus osteopathischer Sicht
(Treatment of the visceral vessels from an osteopathic point of view)
Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
3006

The effect of osteopathic intervention and corrective exercise on golf performance: a prospective case series
Miles, J. I. W.
Unpublished MSc thesis, 2016/09
Free full text
3007

Case report of osteopathic treatment of insomnia and traumatic anhidrosis
Nobles, T., Bach, A., Boesler, D.
International Journal of Osteopathic Medicine, 2016/09
3008

Factors affecting help-seeking behaviour of women with urinary incontinence; a commentary providing insights for osteopaths
Robinson, M., Humpage, C.
International Journal of Osteopathic Medicine, 2016/09
3009

The potential of osteopathic manipulative treatment in antimicrobial stewardship: A narrative review
Noll, D. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
3010

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
3011

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text
3012

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text
3013

Benefits of Craniosacral Therapy in Patients with Chronic Low Back Pain: A Randomized Controlled Trial
Castro-Sánchez, A. M., Lara-Palomo, I. C., Matarán-Peñarrocha, G. A., Saavedra-Hernández, M., Pérez-Mármol, J. M., Aguilar-Ferrándiz, M. E.
The Journal of Alternative and Complementary Medicine, 2016/08
3014

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text
3015

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text
3016

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text
3017

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text
3018

The paradox of sham therapy and placebo effect in osteopathy: A systematic review
Cerritelli, F., Verzella, M., Cicchitti, L., D', Alessandro, G., Vanacore, N.
Medicine (Baltimore), 2016/08
Free full text
3019

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text
3020

Nutrition Knowledge and Attitude Towards Nutrition Counseling Among Osteopathic Medical Students
Hargrove, E. J.
Unpublished MSc thesis, 2016/08
Free full text
3021

The effect of osteopathic manual therapy with breathing retraining on dysfunctional breathing and exercise economy: a randomised controlled trial
Barnett, L. E.
Unpublished MSc thesis, 2016/08
Free full text
3022

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08
3023

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text
3024

Effects of an e-learning programme on osteopaths’ back pain attitudes: a mixed methods feasibility study
Draper-Rodi, J.
Unpublished PhD thesis, 2016/07
Free full text
3025

Psychoneuroimmunologie: eine osteopathische Annäherung
(Psychoneuroimmunology: an osteopathic approach)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
3026

The tongue after whiplash: case report and osteopathic treatment
Bordoni, B., Marelli, F., Morabito, B.
International Medical Case Reports Journal, 2016/07
Free full text
3027

Naturheilkunde und Komplementarmedizin in medizinischen Leitlinien - konnen europaische Normen Leitlinien fur Naturheilkunde und Komplementarmedizin verdrangen?
(Naturopathy and Complementary Medicine in Medical Guidelines - Can European Standards Replace Guidelines for Naturopathy and Complementary Medicine?)
Jutte, R.
Forschende Komplementärmedizin, 2016/07
3028

Repeat-measures longitudinal study evaluating behavioural and gastrointestinal symptoms in children with autism before, during and after visceral osteopathic technique (VOT)
Bramati-Castellarin, I., Patel, V. B., Drysdale, I. P.
Journal of Bodywork and Movement Therapies, 2016/07
3029

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07
3030

Dynamik der Gedanken oder wenn das Denken den Rhythmus lähmt
(Dynamics of thinking or when thinking paralyzes rhythm)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
3031

Im Gespräch mit … Kilian Dräger
(In dialog with Kilian Dräger)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
3032

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text
3033

Osteopathic manipulative therapy is feasible and safe after abdominal surgery
King, H. H.
The Journal of the American Osteopathic Association, 2016/07
Free full text
3034

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text
3035

Psyche und Hormonsystem – Dirigenten unseres Lebens
(Psyche and endocrine system - conductors of our life)
Vogt, E. S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
3036

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text
3037

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text
3038

Management of Cesarean Deliveries and Cesarean Scars With Osteopathic Manipulative Treatment: A Brief Report
Martingano, D.
The Journal of the American Osteopathic Association, 2016/07
Free full text
3039

Osteopathy in the cranial field - an investigation into patient perception, satisfaction and self-reported outcomes of a single treatment session
Judkins, R. M.
Unpublished MSc thesis, 2016/07
Free full text
3040

Osteopathic Approach to the Diagnosis of Appendiceal Mucinous Cystadenocarcinoma Mimicking Primary Ovarian Malignant Neoplasm
Martingano, D., Gurm, H., Oliff, A., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2016/07
Free full text
3041

Pseudoischialgie bei Dysfunktion der Fibula
(Pseudo sciatica in dysfunction of the fibula)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
3042

Confirmatory factor analysis of the Study Process Questionnaire in an Australian osteopathy student population
Vaughan, Brett
International Journal of Osteopathic Medicine, 2016/06
3043

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06
3044

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text
3045

The use of osteopathic manipulative treatment as part of an integrated treatment for infantile colic:A case report
Snider, K. T.
The AAO Journal, 2016/06
3046

Response of Tinnitus to Osteopathic Manipulation
Kurisu, M., Alexander, J., Fleming, J., King, H.
Journal of Integrative and Complementary Medicine, 2016/06
3047

Osteopathische Initiative für Flüchtlinge
(Osteopathic initiative for refugees)
Prediger, G.
Osteopathische Medizin, 2016/06
3048

Red-Reflex-Test in der Osteopathie – eine systematische Literaturübersicht
(Red reflex test in osteopathy - A systematic literature review)
Rotter, G.
Osteopathische Medizin, 2016/06
3049

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06
3050

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text
3051

Osteopaths in the United Kingdom and Australia: Attitudes, practice, confidence and knowledge with regard to melanoma recognition – An observational questionnaire study
Jelineck, S., Bettles, S., Bright, P., Jäkel, A.
International Journal of Osteopathic Medicine, 2016/06
3052

Osteopatia e lombalgia
(Osteopathy and low back pain)
de Oliveira Meirelles, F.
Unpublished MSc thesis, 2016/06
Free full text
3053

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06
3054

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
3055

Randomised controlled pilot trial on feasibility, safety and effectiveness of osteopathic MANipulative treatment following major abdominal surgery (OMANT pilot trial)
Probst, P., Büchler, E., Doerr-Harim, C., Knebel, P., Thiel, B., Ulrich, A., Diener, M. K.
International Journal of Osteopathic Medicine, 2016/06
3056

O desenvolvimento profissional do osteopata: Representações de profissionais em início decarreira
(The professional development of an osteopath: Representations of early-career professionals)
Pedro, J. C. F.
Unpublished MSc thesis, 2016/06
Free full text
3057

Osteopathische Behandlungstechnik für die Fascia clavipectoralis
(Osteopathic treatment techniques for fascia clavipectoralis)
Baumgart, V.
Osteopathische Medizin, 2016/06
3058

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06
3059

(Manual medicine and osteopathic methods on the growing spine)
Kayser, R., Harke, G.
Der Orthopäde, 2016/06
3060

Ergänzende Anmerkungen zum Artikel „Osteopathische Behandlungstechnik für die Fascia clavipectoralis”
(Supplementary notes on the article “Osteopathic treatment techniques for fascia clavipectoralis“)
Hartwig, B.
Osteopathische Medizin, 2016/06
3061

State of affairs of osteopathy in the Benelux: Benelux Osteosurvey 2013
van Dun, P. L. S., Nicolaie, M. A., Van Messem, A.
International Journal of Osteopathic Medicine, 2016/06
3062

Experiences of intervertebral motion palpation in osteopathic practice – A qualitative interview study among Swedish osteopaths
Sposato, N. S., Bjerså, K.
Journal of Bodywork and Movement Therapies, 2016/05
3063

Eye contact, appetite, and vomiting improved in children with autism spectrum disorder after visceral osteopathic technique
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
3064

Significant Benefit Shown After Lumbar Disk Surgery Rehabilitation by Inclusion of Osteopathic Intervention
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
3065

Postural Balance and Gait Improved With an Osteopathic Intervention in a Special Needs Population
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
3066

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05
3067

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text
3068

An analysis of the effectiveness of a Midwest osteopathic medical school's pipeline programs: Graduation and GME match of URM and disadvantaged students
Rice, M. J.
Unpublished Dissertation, 2016/05
3069

Osteopathic considerations in obstructive pulmonary disease: A systematic review of the evidence
Raguckas, C., Ference, J., Gross, G. A.
Osteopathic Family Physician, 2016/05
Free full text
3070

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
3071

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
3072

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text
3073

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3074

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3075

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3076

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3077

The patient experience of osteopathic healthcare
Orrock, P. J.
Manual Therapy, 2016/04
3078

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3079

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3080

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3081

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
3082

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03
3083

Osteopathy – a complex business
Vogel, S.
International Journal of Osteopathic Medicine, 2016/03
3084

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
3085

Somatic Dysfunction: A Principled Approach to Diagnosis and the Selection of OMT Modalities
Hruby, R. J.
The AAO Journal, 2016/03
3086

„Pädiatrie und Osteopathie” – Kongress der OSD im November 2015
(“Pediatrics and Osteopathy“ - OSD Congress in November 2015)
Bäumer, C. J.
Osteopathische Medizin, 2016/03
3087

Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms? Eine Pilotstudie
(Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome? A Pilot Study)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
3088

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Pädiatrische Praxis, 2016/03
3089

Pilotstudie: Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms?
(Pilot study: Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome?)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
3090

The Use of Osteopathic Manipulative Treatment for Acute Dental Pain: A Case Report
Snider, K. T.
The AAO Journal, 2016/03
3091

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text
3092

Im Gespräch mit ... Martina Seidler
(In dialog with Martina Seidler)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
3093

Resolution of Concussion Symptoms After Osteopathic Manipulative Treatment: A Case Report
Guernsey, D. T., Leder, A., Yao, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3094

20. Europäisches Symposium der Traditionellen Osteopathie
(The 20th European Symposium of Traditional Osteopathy)
Pauler, A.
Osteopathische Medizin, 2016/03
3095

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
3096

Hörsturz bei einem Kind nach Beginn einer kieferorthopädischen Behandlung
(Hearing loss in a child after start of an orthodontic treatment)
Refle, S.
Osteopathische Medizin, 2016/03
3097

Groß- und Minderwuchs in der osteopathischen Praxis
(Large and small stature in osteopathic practice)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
3098

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3099

Knowing hands converse with an expressive body - An experience of osteopathic touch
Consedine, S., Standen, C., Niven, E.
International Journal of Osteopathic Medicine, 2016/03
3100

Evaluation of an interprofessional team-based learning nutrition and lifestyle modification course
Pogge, E.
Journal of Interprofessional Care, 2016/03
3101

Craniomandibuläre Dysfunktion. Welchen Stellenwert hat Osteopathie in der interdisziplinären Behandlung von Patienten mit craniomandibulärer Dysfunktion (CMD) in Bezug auf Lebensqualität?
(What influence on quality of life does osteopathy have in interdisciplinary treatment of patients suffering from temporomandibular disorder?)
Schmidt, N.
Unpublished MSc thesis, 2016/03
Free full text
3102

Letter to the Editor Regarding “A global view of osteopathy – Mirror or echo chamber”
King, H. H.
International Journal of Osteopathic Medicine, 2016/03
3103

Targeting Patient Subgroups With Chronic Low Back Pain for Osteopathic Manipulative Treatment: Responder Analyses From a Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3104

Die Veränderung der venösen Wiederauffüllzeit bei Patientinnen und Patienten mit Chronisch-venöser Insuffizienz nach osteopathischer Intervention
(Changes of Venous Refill Time in Male and Female Patients with Chronic Venous Insufficiency after Osteopathic Intervention)
Pink, S.
Unpublished MSc thesis, 2016/03
Free full text
3105

Recovery From Chronic Low Back Pain After Osteopathic Manipulative Treatment: A Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3106

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text
3107

Die Beeinflussung der Kapazität der Vena portae durch eine Mobilisierung der Leber gemessen mit Doppler-Ultraschall
(Influence of osteopathic treatment on the capacity of the portal vein through a mobilisation of liver measured by Doppler ultrasonography)
Maier, M.
Unpublished MSc thesis, 2016/03
Free full text
3108

Osteopathie bei Infantiler Cerebralparese
(Osteopathy for Infant Cerebral Palsy)
Budroni, J.
Unpublished MSc thesis, 2016/03
Free full text
3109

Resolution of New Daily Persistent Headache After Osteopathic Manipulative Treatment
Alexander, J.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3110

Constipation: A review with osteopathic consideration
Cole, S., Moore, C., Shah, P.
Osteopathic Family Physician, 2016/03
3111

Auswirkungen von frühkindlichem Stress auf das neuroendokrine System und Immunsystem
(Effects of early childhood stress on the neuroendocrine system and immune system)
Carter, P. V.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
3112

Schlafstörungen und Epiphyse
(Sleep disorders and pineal gland)
Clostermann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
3113

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03
3114

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03
3115

Osteopathic approach to chronic constipation in Prader–Willi Syndrome: A case report
Smith, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2016/03
3116

Concussions and Osteopathic Manipulative Treatment: An Adolescent Case Presentation
Castillo, I., Wolf, K., Rakowsky, A.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3117

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3118

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text
3119

Abdominal Trigger Points and Psychological Function
Reeves, R. R., Ladner, M. E.
The Journal of the American Osteopathic Association, 2016/02
Free full text
3120

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text
3121

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02
3122

Osteopathic educators' attitudes towards osteopathic principles and their application in clinical practice: A qualitative inquiry
Kasiri-Martino, H., Bright, P.
Manual Therapy, 2016/02
3123

Single Accreditation System for Graduate Medical Education: An Opportunity for Lesbian, Gay, Bisexual, and Transgender Health Education Integration in Osteopathic Medicine
Lapinski, J., Diaz, K. M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
3124

Osteopathic Physicians on the Editorial Boards of Major Medical Journals Over the Past 30 Years
Ashurst, J. V., Galuska, M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
3125

Burnout Among Osteopathic Residents: A Cross-sectional Analysis
Chan, A. M., Cuevas, S. T., Jenkins, J.
The Journal of the American Osteopathic Association, 2016/02
Free full text
3126

Use of complementary and alternative medicine (CAM) by parents in their children and adolescents with epilepsy - Prevelance, predictors and parents' assessment
Hartmann, N., Neininger, M. P., Bernhard, M. K., Syrbe, S., Nickel, P., Merkenschlager, A., Kiess, W., Bertsche, T., Bertsche, A.
European Journal of Paediatric Neurology, 2016/01
3127

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3128

Altersbedingte Veränderungen des Herz-Kreislauf-Systems
(Age-related changes in the cardiovascular system)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
3129

Osteopathic Students' Graduate Medical Education Aspirations Versus Realities: The Relationship of Osteopathic Medicine and Primary Care
Cummings, M.
Academic Medicine, 2016/01
Free full text
3130

Im Gespräch mit … Nicette Sergueef
(In dialog with Nicette Sergueef)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
3131

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
3132

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01
3133

Lumbosakrale Schmerzen und Miktionsbeschwerden bei benignem Prostatasyndrom (BPS)
(Lumbosacral pain and micturition symptoms in benign prostatic hyperplasia (BPH))
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
3134

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
3135

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text
3136

As the Twig Is Bent, so Grows the Tree-Part 6: In a Multicenter Study, OMTh Shortens Length of Stay in the Neonatal Intensive Care Unit
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3137

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text
3138

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text
3139

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text
3140

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
3141

Management of Acute Isolated Soleal Vein Thrombosis in a Pregnant Patient With an Osteopathic Approach to Evaluation
Martingano, D., Eisenberg, J., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3142

The acute effects of a standardised osteopathic manual therapy protocol on the vertical jump and reach performance in healthy basketball players: a cross-over design
Hall, J.
Unpublished MSc thesis, 2016/01
Free full text
3143

An osteopathic approach to the treatment of ovarian cancer
Martingano, D., Cannon, M., Williams, S., Stoner, A.
Osteopathic Family Physician, 2016/01
Free full text
3144

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3145

A formação em osteopatia na Europa: unidade ou diversidade? Os casos da Bélgica, França, Inglaterra e Portugal.
(Osteopathic training in Europe: unity or diversity? The cases of Belgium, France, England and Portugal)
Raimundo, I. S. P.
Unpublished MSc thesis, 2016/01
3146

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3147

Multicenter Osteopathic Pneumonia Study in the Elderly: Subgroup Analysis on Hospital Length of Stay, Ventilator-Dependent Respiratory Failure Rate, and In-hospital Mortality Rate
Noll, D. R., Degenhardt, B. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3148

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
3149

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Gynakologische Praxis, 2016
3150

Review über die osteopathische Behandlung bei obstruktiven Lungenerkrankungen – eine systematische Literaturrecherche
(OMT for obstructice pulmonary diseases – a systematic review)
Schäfer, M.
unpublished D.O. thesis, 2016
Free full text
3151

Arguments for and against movement at the spheno-occipital synostosis: Furthering the debate
Starkey, R.
International Journal of Osteopathic Medicine, 2015/6
3152

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text
3153

Rising to New Challenges: Problems and Proposed Solutions for Osteopathic Program Directors
Goldmann, S. I.
The AAO Journal, 2015/12
3154

Effect of Select Osteopathic Manipulative Treatment Techniques on Patients With Acute Rhinosinusitis
Nishida, Y., Sopchak, M. M., Jackson, M. R., Andersonning, T. R., Leikert, E. P., Goldman, S. I., Jarski, R. W.
The AAO Journal, 2015/12
3155

Cranial and Fascial Distortion Techniques Used as Complementary Treatments to Alleviate Migraine Headache: A Case Report
Ribar, J. S., Capistrant, T. A.
The AAO Journal, 2015/12
3156

Das Urteil des Oberlandesgerichts Düsseldorf vom 8. September 2015
(The decision of the Higher Regional Court Düsseldorf dated September 8, 2015)
Newiger, C.
Osteopathische Medizin, 2015/12
3157

15 Jahre Osteopathische Medizin: ein Interview mit den Gründungsherausgebern
(15 years of Osteopathische Medizin: An interview with the founding editors)
Newiger, C.
Osteopathische Medizin, 2015/12
3158

The Educational Model of Private Colleges of Osteopathic Medicine: Revisited for 2003-2013
Cummings, M.
Academic Medicine, 2015/12
Free full text
3159

Vascular Dynamics – ein osteopathischer Behandlungsansatz
(Vascular Dynamics - An osteopathic treatment approach)
Vogt, R.
Osteopathische Medizin, 2015/12
3160

Osteopathic manipulative treatment for chronic nonspecific neck pain: A systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
International Journal of Osteopathic Medicine, 2015/12
3161

Hat eine osteopathische Technik am Ganglion Stellatum eine Auswirkung auf das autonome Nervensystem gemessen an Herz- und Atemfrequenz an gesunden Individuen?
(Does an osteopathic technique on the stellate ganglion have an influence on the autonomic nervous system measured on heart rate and respiratory rate in healthy subjects?)
Hildebrand, E.
Unpublished MSc thesis, 2015/12
Free full text
3162

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text
3163

Top 5 largest osteopathic medical schools. Ranked by total active enrollment for the 2014-15 school year
listed, No authors
Modern Healthcare, 2015/12
3164

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text
3165

Intra-oral osteopathic technique for chronic temporomandibular disorders
Frederikson, H.
Unpublished MSc thesis, 2015/12
Free full text
3166

Osteopathic treatment for unsettled, fussy and irritable infants in their first year of life: mothers’ experiences and effect on infant temperament
Covich, O. A.
Unpublished MSc thesis, 2015/12
Free full text
3167

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12
3168

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text
3169

Geschichte der konservativen Wirbelsaulentherapie.
[History of conservative spinal therapy]
Kladny, B.
Der Unfallchirurg, 2015/12
3170

Kommentar zum Artikel „Craniomandibuläre Dysfunktion: Bedeutung der Körperhaltung bei Okklusionstests”
(Comment on the article “Craniomandibular dysfunction: Importance of body position in occlusion tests“)
Hartwig, B.
Osteopathische Medizin, 2015/12
3171

Objectivation de l'équilibre en stabilité debout et lors du cycle de marche chez le sujet âgé autonome chuteur: apport de l'Ostéopathie
(Objectification of balance stability when standing and walking among elderly fallers: contribution of Osteopathy)
Huard, Y.
Unpublished PhD thesis, 2015/11
Free full text
3172

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
3173

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11
3174

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text
3175

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text
3176

How the distinctive cultures of osteopathic and allopathic medical schools affect the careers, perceptions, and institutional efforts of their anatomy faculties: A qualitative case study of two schools
Brokaw, J. J., Byram, J. N., Traser, C. J., Arbor, T. C.
Anatomical Sciences Education, 2015/11
3177

A Preliminary Comparison of Laryngeal Manipulation and Postural Treatment on Voice Quality in a Prospective Randomized Crossover Study
Kennard, E. J., Lieberman, J., Saaid, A., Rolfe, K. J.
Journal of Voice, 2015/11
3178

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11
3179

Adverse Events Due to Chiropractic and Other Manual Therapies for Infants and Children: A Review of the Literature
Todd, A. J., Carroll, M. T., Robinson, A., Mitchell, E. K. L.
Journal of Manipulative and Physiological Therapeutics, 2015/11
3180

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
3181

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text
3182

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text
3183

Job Satisfaction and Affective Commitment of Osteopathic Medical School Clinical Faculty
Yurvati, A. H.
Unpublished PhD thesis, 2015/11
3184

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text
3185

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text
3186

Person-centered osteopathic practice: patients' personality (body, mind, and soul) and health (ill-being and well-being)
Fahlgren, E., Nima, A. A., Archer, T., Garcia, D.
PeerJ, 2015/10
Free full text
3187

Look but ... please don't touch!
De-Giorgio, F., Panarella, L., Miscusi, M., d', Aloja, E., Spagnolo, A. G., Pascali, V. L., Vetrugno, G.
Medicine, Science and the Law, 2015/10
Free full text
3188

Antwort von Prof. Fuessl.
[Reply from Prof. Fuessl]
MMW - Fortschritte der Medizin, 2015/10
3189

Fibromyalgiesyndrom. Die Patienten fordern Osteopathie
(Fibromyalgia syndrome. Patients request osteopathy)
Zehnle, S.
MMW - Fortschritte der Medizin, 2015/10
3190

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text
3191

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text
3192

Kann eine osteopathische Behandlung den Geburtsverlauf bei der protrahierten Geburt beeinflussen? Klinische Studie
(Does osteopathic treatment influence birth process in cases of prolonged labor or failure to progress in labor? Clinical trial)
Forster, B., Jusek, A.
Unpublished D.O. thesis, 2015/10
3193

(Osteopathic treatment in patients with age-related macular degeneration. Pre-post study)
Ihlow, D.
Unpublished D.O. thesis, 2015/10
3194

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002). Reliabilitätsstudie.
(Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
3195

Systematische Übersichtsarbeit über die Bewegungen des Herzens in der Mobilität und in der Motilität. Systematischer Review
(Heart motion and motility. Systematic review)
Will, T.
Unpublished D.O. thesis, 2015/10
3196

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002).
Reliabilitätsstudie. (Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
3197

Analysis of provider specialties in the treatment of patients with clinically diagnosed back and joint problems
Wilson, F. A., Licciardone, J. C., Kearns, C. M., Akuoko, M.
Journal of Evaluation in Clinical Practice, 2015/10
3198

Interrater-Reliabilität von osteopathischen Befunden am Beispiel der Zwerchfelluntersuchung
(Interrater reliability of osteopathic findings using the example of diaphragmatic examination.)
Körner, J., Porthun, J., Woisetschläger, G.
Osteopathische Medizin, 2015/09
3199

Larson Syndrome of Dysautonomia in Parkinson Disease Managed With Osteopathic Manipulative Treatment: A Case Report
Durrani, M., Mancini, J. D., Flaum, T. B.
The AAO Journal, 2015/09
3200

Embodied Clinical Decision-making in Osteopathic Manipulative Medicine
Esteves, J. E.
The AAO Journal, 2015/09
3201

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09
3202

Osteopathische Universität – ein Entwurf
(Osteopathic University - a concept)
Levin, P.
Osteopathische Medizin, 2015/09
3203

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
3204

Das Rätsel der böhmischen Heiler in der Geschichte der manuellen Therapien
(The enigma of the Czech healers in the history of manual therapies)
Mildenberger, F. G.
Osteopathische Medizin, 2015/09
3205

Implementing the Single Accreditation System for Graduate Medical Education: Seeking Osteopathic Recognition
Shannon, S. C.
The AAO Journal, 2015/09
3206

Rolle der Empathie in der Osteopathie – eine qualitative Studie
(Role of empathy in osteopathy - a qualitative study)
Müller-Steffens, C., Wikus, P.
Osteopathische Medizin, 2015/09
3207

Dysfunction in a Patient With Acute Knee Pain and Osteoarthritis: A Case Report
T., Snider. K.
The AAO Journal, 2015/09
3208

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09
3209

Im Gespräch mit … Dion Kulak
(In dialog with Dion Kulak)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
3210

Inhärente Rhythmen – komplexe psychophysische Synergismen durch Synchronisation
(Inherent rhythms - Complex psychophysical synergisms through synchronization.)
Pelz, H.
Osteopathische Medizin, 2015/09
3211

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text
3212

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text
3213

Testung der Interrater-Reliabilität osteopathischer Befundergebnisse bei Untersuchung des abdominalen Diaphragmas ohne Vorgabe der Testdurchführung.
(Testing the interrater reliability of osteopathic findings in the examination of the abdominal diaphragm without specification of test implementation)
Körner, J.
Unpublished MSc thesis, 2015/09
Free full text
3214

L'osteopathie a 1'epreuve de l'Evidence-Based Medicine.
[Osteopathy and Evidence-Based Medicine]
Dugailly, P. M.
Revue Medicale de Bruxelles, 2015/09
3215

Die osteopathische Behandlung akuter Atemwegserkrankungen im Krankenhaus von Haifa
(The osteopathic treatment of acute respiratory diseases in a hospital in Haifa, Israel)
Waldman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
3216

Letter to the Editor concerning “A Global View of Osteopathic Practice – Mirror or echo chamber?”
Kerr, J.
International Journal of Osteopathic Medicine, 2015/09
3217

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09
3218

Management of mood disorders by osteopaths in New Zealand: A survey of current clinical practice
Kovanur Sampath, K., Roy, D. E.
International Journal of Osteopathic Medicine, 2015/09
3219

Integration of ultrasonography course in the students' curriculum. Is it always useful?
Garnier, H., Wisniewski, J.
Clinical Anatomy, 2015/09
3220

Interventions for preventing and treating low-back and pelvic pain during pregnancy
Liddle, S. D., Pennick, V.
Cochrane Database of Systematic Reviews, 2015/09
Free full text
3221

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text
3222

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
3223

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09
3224

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text
3225

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
3226

Basic Mechanisms of Osteopathic Manipulative Treatment: A Must Read
Patterson, M. M.
The Journal of the American Osteopathic Association, 2015/09
Free full text
3227

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text
3228

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text
3229

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text
3230

Colic in infants
Lucassen, P.
BMJ Clinical Evidence, 2015/08
Free full text
3231

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text
3232

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text
3233

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text
3234

Im Gespräch mit … Jane Eliza Stark
(In dialog with Jane Eliza Stark)
Höppner, J.P., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3235

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text
3236

Numbers of MD and DO Graduates in Graduate Medical Education Programs Accredited by the Accreditation Council for Graduate Medical Education and the American Osteopathic Association
Jolly, P., Lischka, T., Sondheimer, H.
Academic Medicine, 2015/07
Free full text
3237

Effects of Osteopathic Manipulative Treatment on Diabetic Gastroparesis
Van Ravenswaay, V. J., Hain, S. J., Grasso, S., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2015/07
Free full text
3238

Osteopathische Behandlung bei Patienten mit essenzieller Hypertonie
(Osteopathic treatment in patients with essential hypertension)
Pfeifer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3239

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text
3240

Die Bedeutung der Flüssigkeitsdynamik innerhalb des primären Atemmechanismus
(The importance of fluid dynamics within the primary respiratory mechanism)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3241

A unifying neuro-fasciagenic model of somatic dysfunction – Underlying mechanisms and treatment – Part II
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2015/07
3242

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text
3243

Assessing the immediate effect of osteopathic manipulation on sports related concussion symptoms
Chappell, C., Dodge, E., Dogbey, G. Y.
Osteopathic Family Physician, 2015/07
Free full text
3244

Lass die Natur ihre Arbeit machen
(Let nature do its job)
Deslee, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3245

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3246

Das vaskuläre System als Hilfe für eine präzise anatomische Palpation
(The vascular system as an aid for precise anatomical palpation)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3247

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
3248

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
3249

Role of Osteopathic Manipulative Treatment in a Dynamic Case of Parkinson Disease and Levodopa-Induced Dyskinesia: A Case Report
Apoznanski, T. E., Flaum, T. B.
The AAO Journal, 2015/06
3250

Einfluss zirkadianer Rhythmik auf den Kurzzeiteffekt eines myofaszialen Release des Zwerchfells hinsichtlich vagaler Modulation der Herzratenvariabilität
(Influence of circadian rhythmicity on the short-term effect of a myofascial release of the diaphragm with respect to vagal modulation of heart rate variability)
Hofer, U.
Unpublished MSc thesis, 2015/06
Free full text
3251

Role of osteopathic manipulative treatment in the management of stiff person syndrome
Rajaii, R. M., Cox, G. J., Schneider, R. P.
The Journal of the American Osteopathic Association, 2015/06
Free full text
3252

Effects of the Fourth Ventricle Compression in the Regulation of the Autonomic Nervous System: A Randomized Control Trial
Cardoso-de-Mello-e-Mello-Ribeiro, A. P., Rodríguez-Blanco, C., Riquelme-Agulló, I., Heredia-Rizo, A. M., Ricard, F., Oliva-Pascual-Vaca, Á.
Evidence-Based Complementary and Alternative Medicine, 2015/06
Free full text
3253

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text
3254

Osteopathic Manipulative Treatmentfor Patient With Severe Nausea and Vomiting in Pregnancy: A Case Study
Markelz, K. A., Blumer, J. U.
The AAO Journal, 2015/06
3255

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
3256

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
3257

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06
3258

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06
3259

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06
3260

Learning Environment, Preparedness and Satisfaction in Osteopathy in Europe: The PreSS Study
Luciani, E., van Dun, P. L., Esteves, J. E., Lunghi, C., Petracca, M., Papa, L., Merdy, O., Jakel, A., Cerritelli, F.
PLoS One, 2015/06
Free full text
3261

The effect of osteopathic manipulative treatment on length of stay in posterolateral postthoracotomy patients: A retrospective case note study
Fleming, R. K., Snider, K. T., Blanke, K. J., Johnson, J. C.
International Journal of Osteopathic Medicine, 2015/06
3262

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text
3263

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06
3264

Kraniosakrální terapie
(CranioSacral Therapy)
Klimešová, M.
Unpublished MSc thesis, 2015/06
Free full text
3265

The effect of the osteopathic thoracic lymphatic pump technique on salivary secretory immunoglobulin A levels in adults with recurrent upper respiratory tract complaints
Blut, D. P. F.
Unpublished MSc thesis, 2015/06
3266

Osteopathic manipulative treatment for an unusual presentation of fibromyalgia: A case report demonstrating the effectiveness of disease guidelines
Paul, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2015/06
3267

Allied Health practitioners' role in the Chronic Disease Management program: The experience of osteopathic practitioners
Orrock, P. J., Lasham, K., Ward, C.
International Journal of Osteopathic Medicine, 2015/06
3268

Osteopathie als alternative Therapie bei Reizmagen – eine Pilotstudie
(Osteopathy as an alternative therapy for dyspepsia - A pilot study)
Elsing, C.
Osteopathische Medizin, 2015/06
3269

Einfluss einer Behandlung der lateralen Ventrikel auf die Hirnaktivität – eine Pilotstudie
(Influence of a treatment of the lateral ventricle on brain activity - A pilot study)
Fröhlich, B.
Osteopathische Medizin, 2015/06
3270

Durchblick trotz Wolke: Verwaltung von osteopathischen Praxen per Software
(Perspective in spite of the cloud: Management of osteopathic practices per software)
Hartlep, M.
Osteopathische Medizin, 2015/06
3271

Impact of osteopathic manipulative therapy on quality of life of patients with deep infiltrating endometriosis with colorectal involvement: results of a pilot study
Darai, C., Deboute, O., Zacharopoulou, C., Laas, E., Canlorbe, G., Belghiti, J., Zilberman, S., Ballester, M., Darai, E.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2015/05
3272

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text
3273

Systematic Review Challenges Efficacy of Pediatric OMT
Martincik, L., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
3274

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05
3275

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text
3276

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text
3277

Variations in the diagnosis and treatment of somatic dysfunction between 4 osteopathic residency programs
Hon, G. A., Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/05
Free full text
3278

The extent of familial hypercholesterolemia instruction in US schools and colleges of medicine, pharmacy, and osteopathic medicine
Withycombe, B., Winden, J. C., Hassanyn, R., Duell, P. B., Ito, M. K.
Journal of Clinical Lipidology, 2015/05
3279

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text
3280

Kritische Betrachtung einer Besprechung
(Critical consideration of a critique)
Franke, H., Franke, J.D., Fryer, G.
Manuelle Medizin, 2015/05
3281

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text
3282

The impact of MD and DO attitudes and beliefs on their willingness to collaborate clinically with chiropractors
McGregor, D. M.
Unpublished PhD thesis, 2015/05
3283

Effects of osteopathic manipulative treatment on the inflammatory mediators related to asthma
Ragland, C. E.
Unpublished MSc thesis, 2015/05
3284

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04
3285

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3286

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3287

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3288

Evolution of AOA specialty board certification
Scheinthal, S., Wieting, J. M., Elko, E., Bowling, J., Gonzalez, F., Librizzi, R., Murcek, B., Simms, B.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3289

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3290

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3291

President's message
Morrone, W.
Journal of Addictive Diseases, 2015/04
3292

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3293

Im Gespräch mit … Henry Kleßen
(In dialog with Henry Kleßen)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3294

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3295

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3296

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04
3297

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3298

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3299

Can osteopathic manipulative treatment modify the posture in elderly people? – A single-case study
Pellerin, F., Papin-Richard, E., Guihéneuc, P., Niel, S., Guihard, G.
Journal of Bodywork and Movement Therapies, 2015/04
3300

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3301

Developing a clinical teaching quality questionnaire for use in a university osteopathic pre-registration teaching program
Vaughan, B.
BMC Medical Education, 2015/04
Free full text
3302

Does visceral osteopathic treatment accelerate meconium passage in very low birth weight infants?- A prospective randomized controlled trial
Haiden, N., Pimpel, B., Kreissl, A., Jilma, B., Berger, A.
PLoS One, 2015/04
Free full text
3303

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3304

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3305

„Meine Mitte ist verschoben!“
(“My center is shifted!“)
Weese, P.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3306

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text
3307

Wahrnehmungsstörungen bei Grundschulkindern durch Störungen des hochzervikalen Bereichs
(Perception disorders in elementary school children due to disorders of the high cervical area)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
3308

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3309

An exploration of the changes in signs and symptoms associated with sleep bruxism that follow osteopathic manual therapy: a pilot study
Messersmith, L.
Unpublished MSc thesis, 2015/04
Free full text
3310

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04
3311

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3312

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3313

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3314

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3315

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
3316

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3317

Osteopathische Behandlung der Entrapmentneuropathie des Nervus axillaris
(Osteopathic treatment of entrapment neuropathy of the axillary nerve)
Lefelmann, A.K.
Osteopathische Medizin, 2015/03
3318

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text
3319

Day-to-day practice of osteopaths using osteopathy in the cranial field, who are affiliated with the Sutherland Cranial College of Osteopathy (SCCO): A national survey by means of a standardised data collection tool
Wilkinson, J., Thomas, K. J., Freeman, J. V., McKenna, B.
International Journal of Osteopathic Medicine, 2015/03
3320

Dramatic Reduction in Menstrual Pain After Osteopathic Manipulative Therapy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3321

OMT—and Placebo—Shown Effective in Reducing Pain During Pregnancy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3322

Chiropraktik in der Bundesrepublik Deutschland von 1949 bis 1975
(Chiropractic in the Federal Republic of Germany from 1949 to 1975)
Mildenberger, F. G.
Osteopathische Medizin, 2015/03
3323

19. Europäisches Symposium der traditionellen Osteopathie
(The 19th European Symposium of Traditional Osteopathy)
Müller, F.
Osteopathische Medizin, 2015/03
3324

Application of osteopathic manipulative technique in the treatment of back pain during pregnancy
Majchrzycki, M., Wolski, H., Seremak-Mrozikiewicz, A., Lipiec, J., Marszalek, S., Mrozikiewicz, P. M., Klejewski, A., Lisinski, P.
Ginekologia Polska, 2015/03
3325

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text
3326

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03
3327

The accuracy of osteopathic manipulations of the lumbar Spine: A Pilot study
Frantzis, E., Druelle, P., Ross, K. E., McGill, S.
International Journal of Osteopathic Medicine, 2015/03
3328

Hypothyreose – können Laborwerte und körperliche Beschwerden durch osteopathische Behandlung beeinflusst werden?
(The Influence of Osteopathic Treament on Biochemical Parameters and Physical Problems in Patients with Hypothyreosis)
Monninger, K.
Unpublished MSc thesis, 2015/03
Free full text
3329

Stress und Stressmanagement bei OsteopathInnen
(Stress and Stress Management of Osteopaths)
Homa-Konrad, K.
Unpublished MSc thesis, 2015/03
Free full text
3330

Exploring the construct validity of the Patient Perception Measure - Osteopathy (PPM-O) using classical test theory and Rasch analysis
Mulcahy, J., Vaughan, B.
Chiropractic & Manual Therapies, 2015/03
Free full text
3331

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03
3332

Impact of the clinical ultrasound elective course on retention of anatomical knowledge by second-year medical students in preparation for board exams
Kondrashov, P., Johnson, J. C., Boehm, K., Rice, D., Kondrashova, T.
Clinical Anatomy, 2015/03
3333

Osteopathie: eine Heilmethode auf dem Prüfstand
Snijders, C.
Skeptiker, 2015/03
3334

Osteopathic manipulative treatment use in the emergency department: a retrospective medical record review
Ault, B., Levy, D.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3335

Investigation of instruments measuring healthcare practitioners’ attitudes and beliefs toward low back pain: psychometric properties and survey of New Zealand osteopaths and manipulative physiotherapists
Rushworth, W.
Unpublished MSc thesis, 2015/03
Free full text
3336

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text
3337

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3338

Effectiveness of osteopathic manipulative treatment for carpal tunnel syndrome: a pilot project
Burnham, T., Higgins, D. C., Burnham, R. S., Heath, D. M.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3339

Evidence-based medicine and osteopathic medicine: no paradox
Noll, D. R.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3340

Einfluss der Osteopathie auf den körperlichen und mentalen Zustand von Teenagern
(Influence of osteopathy on the physical and mental states of teenagers)
Egorova, I. A., Buchnov, A. D.
Osteopathische Medizin, 2015/03
3341

Osteopathische Behandlung bei unspezifischen Rückenschmerzen – Literaturübersicht und Metaanalyse
(Osteopathic treatment for unspecific low back pain - systematic review and meta analysis)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2015/03
3342

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03
3343

Postoperative singultus: an osteopathic approach
Petree, K., Bruner, J.
The Journal of the American Osteopathic Association, 2015/03
Free full text
3344

Fluida und Osteopathie – Kongress der Osteopathie Schule Deutschland 2014
(Fluids and Osteopathy - Congress of the Osteopathic School of Germany 2014)
Hohenschurz-Schmidt, D. J.
Osteopathische Medizin, 2015/03
3345

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
3346

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text
3347

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text
3348

Wie zufrieden sind Eltern Frühgeborener in Deutschland mit osteopathischen Behandlungen ihrer frühgeborenen Kinder innerhalb der ersten 3 Lebensjahre?
(Osteopathic treatments on preborn children within their first 3 years: how content are parents with the effects of treatment?)
Papperger, S.
Unpublished MSc thesis, 2015/02
Free full text
3349

Beschreibung der Insertionsstellen des Ligamentum vertebropericardiacum und der Verbindung zum vegetativen Nervensystem: Eine anatomische Grundlagenstudie an nach Thiel konservierten menschlichen Leichen.
(Description of the insertion sites of the ligament vertebropericardiacum and the connection to the autonomic nervous system: A baseline anatomy study in Thiel embalmed human cadavers)
Hoffmann, R.
Unpublished MSc thesis, 2015/02
Free full text
3350

Use of complementary health approaches among children aged 4-17 years in the United States: National Health Interview Survey, 2007-2012
Black, L. I., Clarke, T. C., Barnes, P. M., Stussman, B. J., Nahin, R. L.
National Health Statistics Reports, 2015/02
Free full text
3351

Das Schielen bei Kindern von 2-6 Jahren - Kann es durch osteopathische Behandlung beeinflusst werden?
(Children from 2 to 6 years suffering from strabism - can it be influenced by osteopathic treatment?)
Vietz, C.
Unpublished MSc thesis, 2015/02
Free full text
3352

Umfragestudie zur Entstehung des kindlichen Schielens (Strabismus) durch prä- bzw. perinatale Einflüsse
(Questionnaire study on the emergence of childhood strabism because of prenatal and perinatal influences)
Vietz, M.
Unpublished MSc thesis, 2015/02
Free full text
3353

Osteopatia como meio terapêutico nas disfunções temporomandibulares e dores orofaciais
(Osteopathy as a therapeutic tool in temporomandibular disorders and orofacial pain)
Ferreira, L. T.
Unpublished MSc thesis, 2015/02
Free full text
3354

Resolution of dacryostenosis after osteopathic manipulative treatment
Apoznanski, T. E., Abu-Sbaih, R., Terzella, M. J., Yao, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
3355

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text
3356

Promoting optimal breastfeeding through the osteopathic therapeutic cycle
Cornall, D.
Unpublished PhD thesis, 2015/02
Free full text
3357

Sutherlands Herangehensweise an den Körper als Ganzes: Die Schoßtechnik
(Sutherland's approach to the body as a whole: the lap technique)
Chandler, P., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
3358

Pain: Alternative to a Narco-Epidemic
Moreau, M.
Unpublished Dissertation, 2015/01
3359

Osteopathic Manipulative Treatment Improves Clinical Response and Lowers Relapse Rates Among Patients With Chronic Low Back Pain
Brohard, J. N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
Free full text
3360

Osteopathic Manipulative Treatment Is Effective for Nonspecific Low Back Pain
O'Donnell Rosendahl, N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
3361

Are We Ready to Lead? ACGME Merger: An Opportunity to Fulfill Osteopathy’s Mission
O'Connell, J. A.
The AAO Journal, 2015/01
3362

Im Gespräch mit … Colin Dove
(In dialog with ... Colin Dove)
Möckel, E., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
3363

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: the PROMOTE study
Hensel, K. L., Buchanan, S., Brown, S. K., Rodriguez, M., Cruser d, A.
American Journal of Obstetrics & Gynecology, 2015/01
Free full text
3364

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text
3365

A pilot study on spatial changes in the maxilla caused by osteopathic therapy
Walter, C., Lechner, K. H., Karl, M.
Quintessence International, 2015/01
3366

A study and revisioning of pedagogy and language from the four viewpoints of Sufism, phenomenology of the body, osteopathy, and evolutionary cosmology: Teachings of love and ecology
Davis, M. E.
Unpublished PhD thesis, 2015/01
3367

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
3368

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text
3369

Osteopathic clinical reasoning for the diagnosis and management of pelvic girdle pain associated with pregnancy: an interpretive descriptive study
Rioufrays, J.
Unpublished MSc thesis, 2015/01
Free full text
3370

Aufrecht im Alter
(Upright in old age)
Eix, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
3371

Racionalidades médicas de los sistemas tradicional colombiano, biomédico y osteopático: una aproximación a la conceptualización de la dolencia del descuaje en Bogotá, Colombia. 2015
(Medical rationalities of the traditional Colombian, biomedical, and osteopathic systems: an approach to the conceptualization of the ailment of descuaje in Bogota, Colombia)
Sanin Pineda, L. F.
Unpublished MSc thesis, 2015/01
Free full text
3372

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01
3373

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
3374

Biografische Notizen zu den Begründern von Osteopathie und Chiropraktik. Andrew Taylor Still und Daniel David Palmer
Endruscheit, U.
Skeptiker, 2015/01
3375

A single graduate medical education accreditation system: ensuring quality training for physicians and improved health care for the public
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/4
Free full text
3376

Osteopathy decreases the severity of IBS-like symptoms associated with Crohn's disease in patients in remission
Piche, T., Pishvaie, D., Tirouvaziam, D., Filippi, J., Dainese, R., Tonohouhan, M., DeGalleani, L., Nebot-Vivinus, M. H., Payrouse, J. L., Hebuterne, X.
European Journal of Gastroenterology & Hepatology, 2014/12
3377

Clinical response and relapse in patients with chronic low back pain following osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Aryal, S.
Manual Therapy, 2014/12
Free full text
3378

Open the Box - An Empirical Research Concering the Evaluation of the Black-Box-Model in the Osteopathic Medicine
Müller, S.
Unpublished MSc thesis, 2014/12
Free full text
3379

Pitfalls and challenges involved in the process of perception and interpretation of palpatory findings
Liem, T.
International Journal of Osteopathic Medicine, 2014/12
3380

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text
3381

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12
3382

Intuition, analysis and reflection: An experimental study into the decision-making processes and thinking dispositions of osteopathy students
Spadaccini, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2014/12
3383

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12
3384

(Letter to GM Ostendorf: osteopath --an independent health professional? In: Insurance Medicine 66 (2014), No. 2, pp 97th)
Psczolla, M.
Versicherungsmedizin, 2014/12
3385

Mit welchen Problemen kommen Eltern mit ihren Kindern im ersten Lebensjahr zum/zur OsteopathenIn und welche somatischen Dysfunktionen werden dabei gefunden?
(Which problems make parents approaching an osteopath for their children in their first year of life and which somatic dysfunctions can be found?)
Mellitzer, E.
Unpublished MSc thesis, 2014/12
Free full text
3386

Cardiovascular Response to Vertebral Osteopathic Manipulative Treatment (OMT), On Asymptomatic Human Subjects
Pedapati, C.
Unpublished MSc thesis, 2014/12
3387

The accelerated physician assistant pathway: a three-year medical school curriculum for physician assistants to obtain DO degrees
Kauffman, M., Ferretti, S. M.
Academic Medicine, 2014/12
Free full text
3388

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text
3389

A prodromal, musculoskeletal presentation of Parkinson's disease: A case report
Simpson, P. A.
International Journal of Osteopathic Medicine, 2014/12
3390

Osteopathic manual therapy as an adjunct treatment for self-management of breast cancer related lymphoedema: the lived experience of lymphoedema and osteopathic treatment
Henderson, K.
Unpublished MSc thesis, 2014/12
Free full text
3391

Use of real-time physiologic parameter assessment to augment osteopathic manipulative treatment training for first-year osteopathic medical students
Heath, D. M., Makin, I. R., Pedapati, C., Kirsch, J.
The Journal of the American Osteopathic Association, 2014/12
Free full text
3392

Osteopathic decapitation: Why do we consider the head differently from the rest of the body? New perspectives for an evidence-informed osteopathic approach to the head
Gabutti, M., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2014/12
3393

Osteopathic treatment in patients with primary dysmenorrhoea: A randomised controlled trial
Schwerla, F., Wirthwein, P., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2014/12
3394

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12
3395

Model to Predict Student Performance on the Comprehensive Osteopathic Medical Licensing Examination-USA Level 1 Based on the Medical College Admission Test, Undergraduate Grade Point Average (GPA), and Osteopathic Medical School GPA
Jeffrey, L., McClain, E. K.
The Journal of the American Osteopathic Association, 2014/12
3396

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text
3397

Piriformis Syndrome: A Case Study
Lee, J. M., McCaffrey, K.
The AAO Journal, 2014/11
Free full text
3398

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text
3399

Using the Strain-Counterstrain Approach to Highlight the Body Unity Within Osteopathic Treatment
Dixneuf, A., Ghattas, B.
The AAO Journal, 2014/11
Free full text
3400

Przydatność terapii czaszkowo-krzyżowej w leczeniu chorych z niespecyficznymi bólami dolnego odcinka kręgosłupa. Doniesienie wstępne
Utility of craniosacral therapy in treatment of patients with non-specific low back pain. Preliminary report
Bialoszewski, D., Bebelski, M., Lewandowska, M., Slupik, A.
Ortopedia, Traumatologia, Rehabilitacja, 2014/11
3401

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text
3402

17. Internationaler Kongress des VOD
(The 17th International Congress of the German Osteopathic Association)
Kaiser, F.
Osteopathische Medizin, 2014/11
3403

Was zeigen osteopathische Tests an bei Patienten mit schmerzhaftem unteren Rücken (low back pain) die eine Modic 1- oder Modic 2-Veränderung haben im Vergleich zu einer Kontrollgruppe mit schmerzhaftem unteren Rücken ohne Modic-Veränderung ?
(What are showing osteopatic tests by patients with low back pain who have a modic 1 or a modic 2 change in comparison to a control group who has low back pain but no modic changes?)
Gutenkauf, F.
Unpublished MSc thesis, 2014/11
Free full text
3404

Prozess der Wahrnehmung und Interpretation von Palpationsbefunden
(Process of perception and interpretation of palpation findings).
Liem, T.
Osteopathische Medizin, 2014/11
3405

Effekt einer Leberbehandlung auf den Laktatwert im Blut von gesunden Erwachsenen
(The effect of an osteopathic treatment of the liver on the blood lactate level of healthy adults)
Hieden, E.
Unpublished MSc thesis, 2014/11
Free full text
3406

Chiropraktik in Deutschland – die Zeit vor 1945
(Chiropractic in Germany - the time before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2014/11
3407

Beeinflussung des autonomen Nervensystems durch eine osteopathische Recoiltechnik am Sternum
(Influencing the autonomic nervous system through the application of an osteopathic recoil technique on the sternum)
Mayrhofer, D.
Unpublished MSc thesis, 2014/11
Free full text
3408

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
3409

Desenvolvimento e aplicação de um protocolo osteopático de tratamento para bebês com refluxo
(Development and application of an osteopathic treatment protocol for infants with reflux)
Gemelli, M.
Unpublished MSc thesis, 2014/11
Free full text
3410

Observational study fails to demonstrate the effectiveness of OMT in decreasing low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
3411

Efeito de Técnicas Osteopáticas Estruturais na Postura e Flexibilidade de Individuos com Escoliose Idiopática do Adolescente
(Effect of Structural Osteopathic Techniques on the Posture and Flexibility of Individuals with Adolescent Idiopathic Scoliosis)
Pelai, E. B.
Unpublished MSc thesis, 2014/11
Free full text
3412

Osteopathic manipulative treatment for postural orthostatic tachycardia syndrome
Goodkin, M. B., Bellew, L. J.
The Journal of the American Osteopathic Association, 2014/11
Free full text
3413

Use of beat-to-beat cardiovascular variability data to determine the validity of sham therapy as the placebo control in osteopathic manipulative medicine research
Henley, C. E., Wilson, T. E.
The Journal of the American Osteopathic Association, 2014/11
Free full text
3414

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text
3415

„Wir Osteopathen sind ein wichtiges Stellglied in der Betreuung von Sportlern“
(“We osteopaths are an important actuator in the care of athletes“)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3416

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with persistent non-specific low back pain after childbirth. A randomized controlled trial)
Belz, S.
Unpublished MSc thesis, 2014/10
Free full text
3417

Myers' response to Tozzi's editorial
Myers, T.
Journal of Bodywork and Movement Therapies, 2014/10
3418

Sensations experienced and patients' perceptions of osteopathy in the cranial field treatment
Mulcahy, J., Vaughan, B.
Journal of Evidence-Based Integrative Medicine, 2014/10
Free full text
3419

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10
3420

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
3421

Das Fasziendistorsionsmodell (nach Typaldos): Die 6 Störungen und deren Behandlung
(The fascial distortion model (according to Typaldos): The 6 disorders and their treatment)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
3422

Osteopathic Manipulative Treatment Induces Enhanced Intracellular Immune Response
Blumer, J.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3423

OMT Is Efficacious for Patients With High Baseline Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3424

Vergleichende Literaturanalyse über die Notwendigkeit der Einführung von Balintgruppen in die (Kinder-)Osteopathie
(Comparative literature analysis on the necessity of introducing balint groups into (pediatric) osteopathy)
Kohlmann, M.
unpublished MSc thesis, 2014/10
Free full text
3425

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3426

Vergleich der haptischen und der taktilen Wahrnehmung von Osteopathen und nicht manualtherapeutisch tätigen Personen. Querschnittsstudie.
(Haptic and tactile perception: a comparison between osteopaths and professionally not manual-acting individuals. A cross-sectional study)
Heitmüller, K.
Unpublished D.O. thesis, 2014/10
3427

Das Supinationstrauma aus osteopathischer Sicht
(The supination trauma from an osteopathic point of view)
Peramo, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3428

Response to letter to the editor
Bolino, G., Mangiulli, T.
Medicine, Science and the Law, 2014/10
Free full text
3429

Osteopathische Behandlung von Schwangeren mit Rückenschmerzen. Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial)
Röhrich, K.
Unpublished D.O. thesis, 2014/10
3430

Onset of complications following cervical manipulation due to malpractice in osteopathic treatment: a case report
Cicconi, M., Mangiulli, T., Bolino, G.
Medicine, Science and the Law, 2014/10
3431

Valuable information about current clinical practice
Vaughan, B., Thomson, O.
Medicine, Science and the Law, 2014/10
Free full text
3432

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text
3433

Osteopathische Behandlung von Kindern mit einer idiopathischen Haltungsasymmetrie. Eine randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in children with idiopathic postural asymmetry. A randomized controlled trial)
Teichmüller, M.
Unpublished D.O. thesis, 2014/10
3434

Der Muskelfaserriss
(The torn muscle fiber)
Taenzer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3435

Changes in rat spinal cord gene expression after inflammatory hyperalgesia of the joint and manual therapy
Ruhlen, R. L., Singh, V. K., Pazdernik, V. K., Towns, L. C., Snider, E. J., Sargentini, N. J., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3436

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in women with persistent non specific low back pain after childbirth. A randomized controlled trial)
Belz, S., Brix, K.
Unpublished D.O. thesis, 2014/10
3437

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
3438

Behandlung eines nach anterior verlagerten Akromioklavikulargelenks (ACG) nach Sporttrauma
(Treatment of an anteriorly dislocated acromioclavicular joint after sports trauma)
Delarue, C.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3439

Osteothek: Schnelle Hilfe und fundierte Informationen für die osteopathische Praxis
(Osteothek: Quick help and sound information for osteopathic practice)
Dierlmeier, D.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3440

Deformations experienced in the human skin, adipose tissue, and fascia in osteopathic manipulative medicine
Chaudhry, H., Bukiet, B., Ji, Z., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3441

Bewegung – osteopathische Domäne oder ungenutztes Potenzial?
(Movement - osteopathic domain or untapped potential?)
Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
3442

Effectiveness of osteopathic manipulative treatment with home based exercises on progressed flexible pes planus
Kim, C.
Unpublished MSc thesis, 2014/10
Free full text
3443

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3444

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3445

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text
3446

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/
3447

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/
3448

Pilot trial of osteopathic manipulative therapy for patients with frequent episodic tension-type headache
Rolle, G., Tremolizzo, L., Somalvico, F., Ferrarese, C., Bressan, L. C.
The Journal of the American Osteopathic Association, 2014/09
Free full text
3449

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text
3450

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09
3451

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09
3452

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
3453

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09
3454

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09
3455

Adverse events in pediatric osteopathy
Kales, S.
Unpublished MSc thesis, 2014/09
Free full text
3456

Osteopathische Interventionsevidenz bei Craniomandibulärer Dysfunktion – ein systematischer Review
(Osteopathic Intervention Evidence in Case of Temporomandibular Disorders - A Systematic Review)
Breunig, B.
Unpublished MSc thesis, 2014/09
Free full text
3457

Osteopathie und ihre Effektivität bei craniomandibulärer Dysfunktion (CMD)
(Osteopathic efficiency regarding craniomandibular dysfunction (CMD))
Maron, A.
Unpublished MSc thesis, 2014/09
Free full text
3458

Osteopathie bei chronischen unteren Rückenschmerzen aus Sicht der PatientInnen. Eine qualitative Studie
(The patient's view on osteopathic treatment of chronic low back pain. A qualitative study)
Brenner, F.
Unpublished MSc thesis, 2014/09
Free full text
3459

Pierre robin sequence in a neonate with suckling difficulty and weight loss
Summers, J., Ludwig, J., Kanze, D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
3460

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text
3461

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text
3462

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text
3463

What about OMT and nutrition for managing the irritable bowel syndrome? An overview and treatment plan
Collebrusco, L., Lombardini, R.
Explore (NY), 2014/09
3464

H-reflex responses to High-Velocity Low-Amplitude manipulation in asymptomatic adults
Groisman, S., Silva, L., Rocha, N., Hoff, F., Rodrigues, M. E., Ehlers, J. A., Diniz, L. R.
International Journal of Osteopathic Medicine, 2014/09
3465

Osteopathie und Naturheilkunde in der Schweiz
(Osteopathy and naturopathy in Switzerland)
Vogel, C.
Osteopathische Medizin, 2014/09
3466

Primary reasons for osteopathic consultation: a prospective survey in Quebec
Morin, C., Aubin, A.
PLoS One, 2014/09
Free full text
3467

A degree of difference: the origins of osteopathy and the first use of the “DO“ designation
Stark, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
3468

Changes in biomechanical dysfunction and low back pain reduction with osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Crow, W. T.
Manual Therapy, 2014/08
Free full text
3469

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
3470

Use of osteopathic manipulative treatment to manage recurrent bouts of singultus
Seidel, B., Desipio, G. B.
The Journal of the American Osteopathic Association, 2014/08
Free full text
3471

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text
3472

Osteopathy as an adjunctive management to standard care for depression in menopausal women
Henderson, P.
Unpublished MSc thesis, 2014/08
Free full text
3473

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text
3474

Effets d'un traitement ostéopathique sur la fonction de la main, des symtômes globaux de la maladie et le statut fonctionnel de personnes atteintes de sclérodermie systémique: une série d'études à cas unique
(Effects of osteopathy on hand function, disease symptoms and functional status in female workers with systemic sclerosis: a series of single case studies)
O'Connor, S.
Unpublished MSc thesis, 2014/08
Free full text
3475

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
3476

Quality of life in patients referring to private osteopathic clinical practice: A prospective observational study
Cerritelli, F., Verzella, M., Barlafante, G.
Complementary Therapies in Medicine, 2014/08
3477

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text
3478

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text
3479

Response: observational study demonstrates that OMT is associated with reduced analgesic prescribing and fewer missed work days
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3480

Im Gespräch mit … Gert Roncada
(In dialog with Gert Roncada)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
3481

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text
3482

„Hoffentlich ist es nicht so schlimm, wie es eh schon ist“ – oder wenn einem das Leben an die Nieren geht
(“I hope it's not as bad as it already is“ - or when life gets to you)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
3483

Stimmt unsere Vorstellung vom venösen System?
(Is our conception of the venous system accurate?)
Thon, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
3484

The OSTEOPATHIC trial demonstrates significant improvement in patients with chronic low back pain as manifested by decreased prescription rescue medication use
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3485

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3486

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
3487

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3488

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3489

Mountaineering-induced bilateral plantar paresthesia
Henderson, K. K., Parker, J., Heinking, K. P.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3490

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3491

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
3492

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3493

Osteopathic Manipulative Treatment in Vestibular Neuritis: A Case Report
Ross, B. S., Johnson, V. M.
The AAO Journal, 2014/06
Free full text
3494

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text
3495

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 2
Hendryx, J. T.
The AAO Journal, 2014/06
Free full text
3496

Comparison of Patient Records From the Still-Hildreth Sanatorium With Published Reports
Ching, L. M., Shaw, H. H.
The AAO Journal, 2014/06
Free full text
3497

Is There a Place for Osteopathy in Parkinson Disease Management? A Retrospective Case Control Study
Catanzaro, M. P., Vazzana, K. M., Chen, A., Mancini, J. D., Yao, S. C.
The AAO Journal, 2014/06
Free full text
3498

The Role of Osteopathic Manipulative Medicine in the Treatment of Dacryostenosis
Apoznanski, T. E., Abu-Sbaih, R., Yao, S. C.
The AAO Journal, 2014/06
Free full text
3499

Diagnostic reasoning in osteopathy – A qualitative study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/06
3500

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
3501

New gestational osteopathy unit at the University Hospital Quiron San Jose of Madrid
Guzman Mora, R.
Revista de Enfermeria, 2014/06
3502

Osteopath--ein eigenstandiger Heilberuf?
(Osteopath - an independent health profession?)
Ostendorf, G. M.
Versicherungsmedizin, 2014/06
3503

Osteopathie in Kenia – humanitäre Hilfe und Engagement gegen die weibliche Genitalverstümmelung
(Osteopathy in Kenya - Humanitarian aid and commitment against female genital mutilation)
Gassmaier, H.
Osteopathische Medizin, 2014/06
3504

Behandlung von Säuglingen mit Regulationsstörungen – Anregungen für die Ausbildung gemäß GAIMH
(Treatment of infants with adjustment disorders - Stimuli for the education according to the GAIMH)
Gillemot, B.
Osteopathische Medizin, 2014/06
3505

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3506

Traumatic Groin Injury in a Football Player: A Case Report
Tsukanov, D., Dowling, D. J., Weiss, L.
The AAO Journal, 2014/06
Free full text
3507

Management of Levator Ani Syndrome With Osteopathic Manipulative Treatment: A Case Study
Yoshida, M., Derenge, D., Worden, K.
The AAO Journal, 2014/06
Free full text
3508

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3509

The effect of cranial osteopathic manual therapy on somatic tinnitus in individuals without otic pathology: Two case reports with one year follow up
Arab, A. M., Nourbakhsh, M. R.
International Journal of Osteopathic Medicine, 2014/06
3510

Application of osteopathy in the cranial field to treat left superior homonymous hemianopsia
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2014/06
3511

An audit of the accuracy of medication documentation in a United Kingdom osteopathic training clinic before and after an educational intervention
Brunt, H., Abbey, H.
International Journal of Osteopathic Medicine, 2014/06
3512

Effect of a general osteopathic treatment on body satisfaction, global self perception and anxiety: A randomized trial in asymptomatic female students
Dugailly, P.M., Fassin, S., Maroye, L., Evers, L., Klein, P., Feipel, V.
International Journal of Osteopathic Medicine, 2014/06
3513

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
3514

Osteopathic approach to sacroiliac dysfunction in a patient with steroid myopathy: case report and literature review
Kohns, D. J., Fitch, D. S.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3515

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3516

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3517

Osteopathie als zusätzliche Leistung gesetzlicher Krankenkassen
(Osteopathy as an additional service of statutory health insurance companies.)
Newiger, C.
Osteopathische Medizin, 2014/06
3518

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06
3519

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3520

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text
3521

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text
3522

Reliability and validity of conversion formulas between comprehensive osteopathic medical licensing examination of the United States level 1 and United States medical licensing examination step 1
Lee, A. S., Chang, L., Feng, E., Helf, S.
Journal of Graduate Medical Education, 2014/06
Free full text
3523

Attributions, influences and outcomes for underrepresented and disadvantaged participants of a medical sciences enrichment pipeline program
Pinckney, C.
Unpublished Dissertation, 2014/05
Free full text
3524

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3525

Response to Letter About “An Unexpectedly Progressed Lumbar Herniated Disk“
Lipton, J. A., McLeod, G. A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3526

OMT Improves Acute Hemodynamic Control in Pregnancy by Means of Improved Venous Return
Seffinger, M. A., Brohard, J. N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3527

G.I. Joe: Could Visceral Osteopathy Help Fight the War against IBS?
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3528

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05
3529

Osteopathy: helping pregnant women in pain
Randall, S.
The Practising Midwife, 2014/05
3530

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3531

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3532

An Unexpectedly Progressed Lumbar Herniated Disk
Gilliss, A. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3533

Determination of Genetic Factors Associated with Response to Osteopathic Manipulative Treatment (OMT) in Individuals with Chronic Lower Back Pain (CLBP)
Richardson, K. K.
Unpublished MSc thesis, 2014/05
3534

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text
3535

Somatic dysfunction and use of osteopathic manual treatment techniques during ambulatory medical care visits: a CONCORD-PBRN study
Licciardone, J. C., Kearns, C. M., King, H. H., Seffinger, M. A., Crow, W. T., Zajac, P., Devine, W. H., Abu-Sbaih, R. Y., Miller, S. J., Berkowitz, M. R., Dyer, R., Heath, D. M., Treffer, K. D., Nevins, N. A., Aryal, S.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3536

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text
3537

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3538

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text
3539

Caring beyond the table: exploring New Zealand osteopaths’ experience of treating pregnant women: a descriptive phenomenological study
McCollum, F.
Unpublished MSc thesis, 2014/05
Free full text
3540

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text
3541

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
3542

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3543

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04
3544

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3545

Development of a data collection tool to profile osteopathic practice: use of a nominal group technique to enhance clinician involvement
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
3546

Anatomical landmark position--can we trust what we see? Results from an online reliability and validity study of osteopaths
Pattyn, E., Rajendran, D.
Manual Therapy, 2014/04
3547

Im Gespräch mit ... Sue Turner
(In dialog with Sue Turner)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
3548

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
3549

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04
3550

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3551

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3552

Auffinden von peripheren Nerven am Beispiel des N. radialis
(Locating peripheral nerves using the radial nerve as an example)
Van Loo, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
3553

Osteopathic management of mild leg length inequality with heel lift therapy: A pilot study analyzing altered gait kinetics and kinematics
Bens, S.
Unpublished MSc thesis, 2014/04
3554

Besserung der Symptome bei Multipler Sklerose
(Improvement of symptoms in multiple sclerosis)
Butenschön, W.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
3555

Honoring the Medicine: searching for the embodiment of spiritual commitment and philosophy for student physicians
Roseman, J. L.
Advances in Mind-Body Medicine, 2014/04
3556

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3557

Approach to low back pain – osteopathy
Vaughan, B., Morrison, T., Buttigieg, D., Macfarlane, C., Fryer, G.
Australian Family Physician, 2014/04
Free full text
3558

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3559

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3560

Do placebo effects associated with sham osteopathic procedure occur in newborns? Results of a randomized controlled trial
Martelli, M., Cardinali, L., Barlafante, G., Pizzolorusso, G., Renzetti, C., Cerritelli, F.
Complementary Therapies in Medicine, 2014/04
3561

Moving from EBM to EBOM: an osteopathic perspective on evidence-based medicine
Danto, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3562

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3563

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3564

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
3565

Osteopathic manipulative treatment as a useful adjunctive tool for pneumonia
Yao, S., Hassani, J., Gagne, M., George, G., Gilliar, W.
Journal of Visualized Experiments, 2014/04
Free full text
3566

Wissenschaftliche Neubewertung der Liquordynamik
(Scientific reassessment of cerebrospinal fluid dynamics)
Hass-Degg, K.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
3567

A profile of osteopathic care in private practices in the United Kingdom: a national pilot using standardised data collection
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
3568

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text
3569

Usefulness of Video Learning for Osteopathic Manipulative Medicine Techniques in the Classroom and Clinical Setting
Meghpara, M., Yao, S. C., Flaum, T. B., Caron, E., Terzella, M. J.
The AAO Journal, 2014/03
Free full text
3570

Resolution of Post-traumatic Temporomandibular Joint Pain, Headache and Vision Changes with OMM in the Unified Field: A Case Report
Lipton, J. A., Case, M. G.
The AAO Journal, 2014/03
Free full text
3571

Research and treatment bulletin
International Journal of Osteopathic Medicine, 2014/03
3572

Osteopathic Manipulative Treatment of Pelvic Dysfunction in a Postpartum Patient with Co-Morbid Headaches: A Case Report
Kant, R., Berkowitz, M. R.
The AAO Journal, 2014/03
Free full text
3573

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 1
Hendryx, J. T.
The AAO Journal, 2014/03
Free full text
3574

Envisioning a global role for osteopathic medicine in the 21st century: Using Blue Ocean Strategy to promote osteopathic health care as the World's leader in healthcare education and do it more efficiently, effectively and at the lowest cost
Slocum, P. C., Papa, F.
International Journal of Osteopathic Medicine, 2014/03
3575

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03
3576

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text
3577

Hydrodynamik des Liquor cerebrospinalis – eine Neubewertung
(Cerebrospinal fluid hydrodynamics - A reassessment)
Chikly, B., Quaghebeur, J.
Osteopathische Medizin, 2014/03
3578

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text
3579

Osteopathic Manipulation in the Treatment of Primary Nocturnal Enuresis: A Retrospective Chart Review
Kanze, D. M., Kanze, K. A.
The AAO Journal, 2014/03
3580

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text
3581

Qualitative evaluation of osteopathic manipulative therapy in a patient with gastroesophageal reflux disease: a brief report
Diniz, L. R., Nesi, J., Curi, A. C., Martins, W.
The Journal of the American Osteopathic Association, 2014/03
Free full text
3582

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text
3583

Assessing criticality in student research reports: Preliminary results from a new educational card sorting activity
Abbey, H., Esteves, J. E., Vogel, S., Tyreman, S. J.
International Journal of Osteopathic Medicine, 2014/03
3584

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03
3585

An investigation into the current practices and educational theories that underpin the teaching of palpation in osteopathic education: A Delphi study
Browning, S.
International Journal of Osteopathic Medicine, 2014/03
3586

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03
3587

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03
3588

The self-directed osteopathic medical student: Bringing adult learning into the osteopathic manipulative technique lab
Jons-Cox, L.A. D.
International Journal of Osteopathic Medicine, 2014/03
3589

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
3590

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text
3591

Effectiveness of visceral osteopathic treatment on gastrointestinal indicators and behaviour patterns in autistic children: using questionnaire and biochemical markers to measure outcomes
Bramati-Castellarin, I.
Unpublished PhD thesis, 2014/03
Free full text
3592

Vestibular dysfunction in patients with chronic pain or underlying neurologic disorders
Gilbert, J. W., Vogt, M., Windsor, R. E., Mick, G. E., Richardson, G. B., Storey, B. B., Herder, S. L., Ledford, S., Abrams, D. A., Theobald, M. K., Cunningham, D., Kelly, L., Herring, K. V., Maddox, M. L.
The Journal of the American Osteopathic Association, 2014/03
Free full text
3593

OMT associated with reduced analgesic prescribing and fewer missed work days in patients with low back pain: an observational study
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/02
Free full text
3594

Clinical decision-making and therapeutic approaches in osteopathy - a qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
3595

A qualitative grounded theory study of the conceptions of clinical practice in osteopathy – A continuum from technical rationality to professional artistry
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
3596

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text
3597

Osteopathie als “eigenstandiger Heilberuf“. Sollen Bademeister auf eigene Faust Patienten behandeln?
(Osteopathy as an “independent healing profession“. Should balneology specialists treat patients independently? )
Ostendorf, G. M.
MMW - Fortschritte der Medizin, 2014/02
3598

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text
3599

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text
3600

Osteopathic manipulative treatment in the management of biliary dyskinesia
Heineman, K.
The Journal of the American Osteopathic Association, 2014/02
Free full text
3601

Mini-medical school programs are an effective tool to introduce students to osteopathic medicine
Kaye, K. E., Berns, A. L., Cress, L. R., Nazar, A. M.
The Journal of the American Osteopathic Association, 2014/02
Free full text
3602

The integration of the “spirituality in medicine“ curriculum into the osteopathic communication curriculum at Kansas City University of Medicine and Biosciences
Talley, J. A., Magie, R.
Academic Medicine, 2014/01
Free full text
3603

Transcending the International Osteopathic Identity: Cross-Sectional Analysis of Osteopathic Principles and Practice in Peru
Lim, L., Sergent, S., Gordon, T., Wiseman, K., Hawkins, J., Willyerd, G., Gorbis, S.
The Journal of the American Osteopathic Association, 2014/01
3604

Pilot Study Comparing 2 Variations of Occipitomastoid Suture (OMS) Release and Their Effects on Blood Pressure and Pulse Rate in Prehypertensive and Hypertensive Individuals Compared With Normotensive Controls
Nelson, J. H., Barnes, P. L., Stouch, B., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2014/01
3605

Changes in Biomechanical Dysfunction With Osteopathic Manual Treatment in Patients With Chronic Low Back Pain According to Diabetes Mellitus Status
Panjwani, R., Kearns, C., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/01
3606

Somatic dysfunction and fascia's gliding-potential
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
3607

Effect of Osteopathic Manipulative Medicine Thoracic Cage Techniques on Parkinson Disease Patients
Vazzana, K. M., Hart, A., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2014/01
3608

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3609

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3610

OMT Relieves Severe Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3611

Systematic Review Paints Incomplete Picture of OMT Research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3612

Im Gespräch mit ... Alison Brown
(In dialog with Alison Brown)
Möckel, E., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
3613

New frontiers in medical education: simulation technology at Campbell University School of Osteopathic Medicine
Maddox, R. W., Schmid, R. J.
North Carolina Medical Journal, 2014/01
3614

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01
3615

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3616

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
3617

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
3618

Componentes de formação no plano de estudos: a componente prática num curso profissional de osteopatia
(Training components in the syllabus: the practical component in a professional osteopathy course)
Barreto, N. M. S.
Unpublished MSc thesis, 2014/01
Free full text
3619

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
3620

Die Galea aponeurotica als fasziale Struktur
(The galea aponeurotica as a fascial structure)
Barty, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
3621

Ein neuer Ansatz zur Behandlung von Haltungsstörungen
(A new approach to the treatment of postural disorders)
Beck, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
3622

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3623

Connectedness, sense of community, and academic satisfaction in a novel community campus medical education model
Vora, R. S., Kinney, M. N.
Academic Medicine, 2014/01
Free full text
3624

Osteopathic Manual Treatment and Ultrasound Therapy for Chronic Low Back Pain: An Illustration of Osteopathic Semantic Confusion
Cymet, T. C.
The Journal of the American Osteopathic Association, 2014/01
Free full text
3625

Osteopathic manual therapy as an adjunct treatment for the self-management of breast cancer related lymphoedema: A prospective case series
Eydt, E.
Unpublished MSc thesis, 2014/01
Free full text
3626

Corrigendum to “Osteopathic Manipulative Treatment (OMT) for Lower Urinary Tract Symptoms (LUTS) in women” [J. Bodyw. Mov. Ther. 17 (2013) 11–18]
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
3627

Osteopathy and low back pain, acupuncture and in vitro fertilization, Tai Chi and osteoarthritis, Andrographis paniculata and ulcerative colitis, and acupressure and vertigo
Pettit, J., Glickman-Simon, R.
Explore (NY), 2014/01
3628

Osteopathic manipulative treatment of congenital talipes equinovarus: a case report
Andreoli, E., Troiani, A., Tucci, V., Barlafante, G., Cerritelli, F., Pizzolorusso, G., Renzetti, C., Vanni, D., Pantalone, A., Salini, V.
Journal of Bodywork and Movement Therapies, 2014/01
3629

Effects of 7-Technique Osteopathic Manipulative Protocol on Patients With COPD
Carter Decker, J., Tylski, E., Stevens Coe, J., McClain, R., Gautam, D., McClain, E. K., Ogden, R., Kolo, G.
The Journal of the American Osteopathic Association, 2014/01
3630

Awareness of Hereditary Cancer in Osteopathic Physicians
Cohn, J. E., Soshnick, S., Blazey, W., Koehler, S., Laurent, B., Chan, V., Jung, M.K., Tegay, D., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2014/01
3631

Efficacy of Osteopathic Manipulative Treatment on Pulmonary Function in Healthy Adult Male Subjects
Hines, P. J., Heinking, K., Henderson, K.
The Journal of the American Osteopathic Association, 2014/01
3632

Effect of Osteopathic Manipulative Treatment on Blood Lactate Clearance After High Intensity Exercise
Khuc, B. M., Mendez, J., Wong, T. S., Hiserote, R. M.
The Journal of the American Osteopathic Association, 2014/01
3633

Efectividad de la técnica osteopática BLT en el tratamiento conservativo del pie equinovaro infantil
(Efficacy of the osteopathic technique BLT in the conservative treatment of pediatric clubfoot)
Kimmerle, F.E.
Unpublished thesis, 2014
3634

Assessing impact of not attending lectures on osteopathic medical student performance: Brief survey of the literature and proposed future research
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/12
3635

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12
3636

Patient perception of osteopathic training in the UK and patient reported experience
Drysdale, I. P., Hinkley, H., Rolfe, K. J.
International Journal of Osteopathic Medicine, 2013/12
3637

Script concordance test: Insights from the literature and early stages of its implementation in osteopathy
Esteves, J. E., Bennison, M., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
3638

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12
3639

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12
3640

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12
3641

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
3642

Introduction to the special issue on osteopathic education
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2013/12
3643

OMT especially recommended for severe low back pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/12
3644

The OSCE in a pre-registration osteopathy program: Introduction and psychometric properties
Vaughan, B., Florentine, P.
International Journal of Osteopathic Medicine, 2013/12
3645

Investigation of standardized patient ratings of humanistic competence on a medical licensure examination using Many-Facet Rasch Measurement and generalizability theory
Zhang, X., Roberts, W. L.
Advances in Health Sciences Education : Theory and Practice, 2013/12
3646

Acute improvement in hemodynamic control after osteopathic manipulative treatment in the third trimester of pregnancy
Hensel, K. L., Pacchia, C. F., Smith, M. L.
Complementary Therapies in Medicine, 2013/12
Free full text
3647

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text
3648

Preventive osteopathic manipulative treatment and stress fracture incidence among collegiate cross-country athletes
Brumm, L. F., Janiski, C., Balawender, J. L., Feinstein, A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
3649

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text
3650

Use of OMT to Treat Patient with Ramsay Hunt Syndrome and HIV: A Case Study
Baker, J. P.
The AAO Journal, 2013/12
Free full text
3651

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
3652

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text
3653

The Application of the Cranial Concept in the Investigation of Baffling Medical Disorders and Their Treatment: A Synergopathic Medical Disease Model
Pribadi, K. S.
The AAO Journal, 2013/12
Free full text
3654

The Effect of the Student American Academy of Osteopathy Summer Preceptorship Program on Students’ Perception of Osteopathic Manipulative Treatment
Vazzana, K. M., Chan, V., Wenzel, C. H., Yao, S. C.
The AAO Journal, 2013/12
Free full text
3655

Lymphatic Pump Treatment Repeatedly Enhances the Lymphatic and Immune Systems
Schander, A., Padro, D., King, H. H., Downey, H. F., Hodge, L. M.
Lymphatic Research and Biology, 2013/12
3656

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text
3657

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12
3658

Patients' expectations of private osteopathic care in the UK
Chippendale, E.
International Journal of Osteopathic Medicine, 2013/12
3659

Treatment of refractory irritable bowel syndrome with visceral osteopathy: short-term and long-term results of a randomized trial
Attali, T. V., Bouchoucha, M., Benamouzig, R.
Journal of Digestive Diseases, 2013/12
3660

The effectiveness of the ‘Bruce Jones sacroiliac technique’ in treatment of people with chronic low back pain: a single cohort design
Hanson, G.
Unpublished MSc thesis, 2013/12
Free full text
3661

Outcomes of osteopathic manual treatment for chronic low back pain according to baseline pain severity: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Minotti, D. E.
Manual Therapy, 2013/12
Free full text
3662

Neu: strukturierte curriculare Fortbildung „Osteopathische Verfahren“
(New: structured curricular training “Osteopathic methods“)
Psczolla, M.
Manuelle Medizin, 2013/12
Free full text
3663

Strukturierte curriculare Fortbildung Osteopathische Verfahren
(Structured curricular advanced training osteopathic methods)
v. Heymann, W., Buchmann, J.
Manuelle Medizin, 2013/12
3664

16. Internationaler Kongress des VOD
(The 16th International Congress of the German Osteopathic Association)
Prediger, G., Risch, A. J.
Osteopathische Medizin, 2013/11
3665

Zukunft und Qualität der Osteopathie in Deutschland
(Future and quality of osteopathy in Germany)
Osteopathische Medizin, 2013/11
3666

Evidenzbasierte Medizin – der Goldstandard auch in der Osteopathie?
(Evidence-based medicine - the golden standard also in osteopathy?)
Hartwig, B.
Osteopathische Medizin, 2013/11
3667

Rib-Raising-Technik verringert den Atemwegswiderstand
(Rib raising technique reduces airway resistance)
Braun, G.
Osteopathische Medizin, 2013/11
3668

Prevalence of visits to five types of complementary and alternative medicine practitioners by the general population: a systematic review
Cooper, K. L., Harris, P. E., Relton, C., Thomas, K. J.
Complementary Therapies in Clinical Practice, 2013/11
3669

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text
3670

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text
3671

Role of osteopathic structural diagnosis and osteopathic manipulative treatment for diabetes mellitus and its complications
Johnson, A. W., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2013/11
Free full text
3672

Pursuit of Complementary and Alternative Medicine Treatments in Adolescents With Cerebral Palsy
Majnemer, A., Shikako-Thomas, K., Shevell, M. I., Poulin, C., Lach, L., Schmitz, N., Law, M., Group the, Q.
Journal of Child Neurology, 2013/11
3673

The attitudes and self-reported practices of New Zealand osteopaths to exercise consultation and its use within osteopathy
Mistry, R.
Unpublished MSc thesis, 2013/11
Free full text
3674

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text
3675

Osteopathic manipulative treatment in tarsal somatic dysfunction: a case study
Batt, J., Neeki, M. M.
The Journal of the American Osteopathic Association, 2013/11
Free full text
3676

Don't Throw the Baby Out With the Bath Water
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3677

Systematic Review of OMTh for Lower Urinary Tract Symptoms in Women Shows Benefit
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3678

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3679

Gegenüberstellung von vizeralen Lehrsystemen verschiedener Osteopathieschulen in Deutschland. Eine Umfrage.
(Comparison of visceral approaches in different osteopathic schools in Germany. Survey)
Clostermann, A.
Unpublished D.O. thesis, 2013/10
3680

Influence of Manual Therapy on Functional Mobility After Joint Injury in a Rat Model
Ruhlen, R. L., Snider, E. J., Sargentini, N. J., Worthington, B. D., Singh, V. K., Pazdernik, V. K., Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3681

Response to “Letter to the Editor Regarding ‘The Somatic Connection: Manual Therapy Is Beneficial for Cervical Radiculopathy””
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3682

Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial
Gundermann, S.
Unpublished D.O. thesis, 2013/10
3683

Bewegung und Stille in der Arbeit mit Kindern
(Movement and stillness while working with children)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
3684

Studienziel: Erhebung von Daten zur psychischen Belastung und Beanspruchung bei der Arbeit von Osteopathen in Deutschland. Studiendesign: Querschnittsstudie.
(Psychosocial working conditions of German osteopaths. Cross-sectional study)
Salandi, C.
Unpublished D.O. thesis, 2013/10
3685

Abseits ausgetretener Pfade: Ein neuer Blick auf die Faszie
(Off the beaten paths: a new look at the fascia)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
3686

Natural Bridge: Wo sich Osteopathie und Natur verbinden
(The Natural Bridge: Where osteopathy and nature combine)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
3687

Im Gespräch mit … Philip van Caille
(In dialog with Philip van Caille)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
3688

Gesichtsfeldeinschränkung nach Unfall
(Visual field impairment after accident)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
3689

Osteopathic dermatology residency training through Nova Southeastern University College of Osteopathic Medicine at Largo Medical Center
Walls, B.
Cutis, 2013/10
Free full text
3690

Pattern and predictors of complementary and alternative medicine (CAM) use among pediatric patients with epilepsy
Doering, J. H., Reuner, G., Kadish, N. E., Pietz, J., Schubert-Bast, S.
Epilepsy & Behavior, 2013/10
3691

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3692

Prevention of progressive back-specific dysfunction during pregnancy: an assessment of osteopathic manual treatment based on Cochrane Back Review Group criteria
Licciardone, J. C., Aryal, S.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3693

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3694

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text
3695

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
3696

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10
3697

Re: An investigation of cranial motion through a review of biomechanically based skull deformation literature
Gabutti, M., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/09
3698

Re: Re: An investigation of cranial motion through a review of biomechanically based skull deformation literature
Kemper, A. R., Brolinson, P. G., Seimetz, C. N., Duma, S. M.
International Journal of Osteopathic Medicine, 2013/09
3699

Osteopathic manipulative treatment (OMT) during labor facilitates a natural, drug-free childbirth for a primigravida patient: A case report
Smallwood, C. R., Borgerding, C. J., Cox, M. S., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/09
3700

Benefits of osteopathic manual treatment on chronic low back pain – At last, a large high quality clinical trial!
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/09
3701

Klinische Forschung in der Osteopathie – Teil 2: neuronale und organische Störungen
(Clinical research in osteopathy - Part 2: Neuronal and organic disorders)
Rauch, A.
Osteopathische Medizin, 2013/09
3702

Osteopathische Behandlung bei psychischen Traumafolgestörungen
(Osteopathic treatment in mental posttraumatic stress disorders)
Krebs, C.A., von Franque, M.
Osteopathische Medizin, 2013/09
3703

Osteopathen in Deutschland: ausgewählte Ergebnisse der Osteopathie-Zählung 2013
(Osteopaths in Germany: Selected results of the 2013 osteopathy census)
Ismail-Tsaous, E.
Osteopathische Medizin, 2013/09
3704

Osteopathie in Portugal staatlich reguliert
(Osteopathy in Portugal is regulated by the state)
Hartlep, M.
Osteopathische Medizin, 2013/09
3705

Thoracic and abdominal lymphatic pump techniques inhibit the growth of S. pneumoniae bacteria in the lungs of rats
Creasy, C., Schander, A., Orlowski, A., Hodge, L. M.
Lymphatic Research and Biology, 2013/09
Free full text
3706

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
3707

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: an illustration of osteopathic semantic confusion. Author reply
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
3708

Osteopathic Management of a Family with Inherited Cervical Dystonia
Mancini, J. D., Burns, D. K.
The AAO Journal, 2013/09
Free full text
3709

Usefulness of Video Learning for Osteopathic Manipulative Medicine (OMM) Techniques in the Educational and Clinical Setting
Meghpara, M. K., Terzella, M. J., Flaum, T. B., Jung, M.K., Yao, S. C.
The AAO Journal, 2013/09
Free full text
3710

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
3711

The importance of residency program size and location on American Osteopathic Board of Surgery In-Training Examination outcomes
Falcone, J. L., Rosen, M. E.
Journal of Surgical Research, 2013/09
3712

A single systems research design to examine the effectiveness of osteopathic treatment for people with osteoarthritis of the hip
Howat, T.
Unpublished MSc thesis, 2013/09
Free full text
3713

Offer and use of complementary and alternative medicine in hospitals of the French-speaking part of Switzerland
Carruzzo, P., Graz, B., Rodondi, P. Y., Michaud, P. A.
Swiss Medical Weekly, 2013/09
Free full text
3714

Osteopath is incorrect term for osteopathic physicians
Kaufman, B.
American Family Physician, 2013/08
Free full text
3715

Evaluation of the acceptability of Peer Physical Examination (PPE) in medical and osteopathic students: a cross sectional survey
Consorti, F., Mancuso, R., Piccolo, A., Consorti, G., Zurlo, J.
BMC Medical Education, 2013/08
Free full text
3716

A profile of osteopathic practice in Australia 2010-2011: a cross sectional survey
Burke, S. R., Myers, R., Zhang, A. L.
BMC Musculoskeletal Disorders, 2013/08
3717

Interventions for preventing and treating pelvic and back pain in pregnancy
Pennick, V., Liddle, S. D.
Cochrane Database of Systematic Reviews, 2013/08
Free full text
3718

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text
3719

Relighting the fire in our bellies
Cain, R. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
3720

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text
3721

Conservative approach to tardive dyskinesia-induced neck and upper back pain
Reifsnyder, J. W., Tettambel, M. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
3722

Mathematical analysis of the flow of hyaluronic acid around fascia during manual therapy motions
Roman, M., Chaudhry, H., Bukiet, B., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2013/08
Free full text
3723

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08
3724

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08
3725

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08
3726

Peripheral Skin Blood Flow Changes After Different Controlled Cervical Osteopathic Mobilizations: A Pilot Study
Zegarra Parodi, R., Kvam, V., Park, P., Shurtz, N. R., Webb, S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/08
3727

Further Demonstration of the Benefit of Osteopathic Manipulative Therapy in Pediatric Care
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3728

Visceral Manipulation Is Shown to Reduce Postoperative Ileus in an Animal Model
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3729

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3730

Osteopathic Manipulative Treatment Is Efficacious for Management of Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3731

Die osteopathische Behandlung der Geburtserfahrung
(Osteopathic treatment of the birth experience)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
3732

Im Gespräch mit … Dr. Dina Guerassimiouk
(In dialog with Dr. Dina Guerassimiouk)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
3733

Langfristige Begleitung eines Kindes mit spastischer Hemiparese
(Long-term treatment of a child with spastic hemiparesis)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
3734

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
3735

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3736

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3737

Osteopathic manipulative treatment for facial numbness and pain after whiplash injury
Genese, J. S.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3738

The short-term effect of a lymphatic pump protocol on blood cell counts in nursing home residents with limited mobility: a pilot study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text
3739

Fascia's function: classical osteopathic perspectives and current research compared
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text
3740

Reassessing cerebrospinal fluid (CSF) hydrodynamics: a literature review presenting a novel hypothesis for CSF physiology
Chikly, B., Quaghebeur, J.
Journal of Bodywork and Movement Therapies, 2013/07
3741

Changes in alpha band activity associated with application of the compression of fourth ventricular (CV-4) osteopathic procedure: A qEEG pilot study
Miana, L., Hugo do Vale Bastos, V., Machado, S., Arias-Carrión, O., Nardi, Antonio E., Almeida, L., Ribeiro, P., Machado, D., King, H., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text
3742

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07
3743

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07
3744

Osteopathische Diagnostik und Behandlung bei Stillproblemen
(Osteopathic diagnostics and treatment for breastfeeding problems)
Haller, L.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
3745

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06
3746

Osteopathic intervention for chronic pain, remaining thoracic stiffness and breathing impairment after thoracoabdominal oesophagus resection: A single subject design study
Bjerså, K., Sachs, C., Hyltander, A., Fagevik Olsén, M.
International Journal of Osteopathic Medicine, 2013/06
3747

Item development for a questionnaire investigating patient self reported perception, satisfaction and outcomes of a single osteopathy in the cranial field (OCF) treatment
Mulcahy, J., Vaughan, B., Boadle, J., Klas, D., Rickson, C., Woodman, L.
International Journal of Osteopathic Medicine, 2013/06
3748

Palpatory phenomena in the limbs: A proposed mechanism
Scarr, G.
International Journal of Osteopathic Medicine, 2013/06
3749

Gesundheit durch Ganzheit – ein osteopathisch-salutogenetischer Ansatz
(Health by means of wholeness - An osteopathic-salutogenic approach)
Risch, A. J.
Osteopathische Medizin, 2013/06
3750

Klinische Forschung in der Osteopathie – Teil 1: muskuloskelettale Störungen
(Clinical research in osteopathy - Part 1: Musculoskeletal disorders)
Rauch, A.
Osteopathische Medizin, 2013/06
3751

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06
3752

Compliance with clinical guidelines for whiplash improved with a targeted implementation strategy: a prospective cohort study
Rebbeck, T., Macedo, L. G., Maher, C. G.
BMC Health Services Research, 2013/06
Free full text
3753

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06
3754

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
3755

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text
3756

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text
3757

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text
3758

Treatment of a posterior rib utilizing a multimodal sequence of osteopathic manipulative treatments
Baker, J. P., Ely, R.
The AAO Journal, 2013/06
Free full text
3759

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text
3760

Relief of persistent jaw pain with the use of osteopathic manipulative medicine
Lipton, J. A., Covington, J. D.
The AAO Journal, 2013/06
Free full text
3761

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
3762

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text
3763

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
3764

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06
3765

Patients' expectations of private osteopathic care in the UK: a national survey of patients
Leach, C. M., Mandy, A., Hankins, M., Bottomley, L. M., Cross, V., Fawkes, C. A., Fiske, A., Moore, A. P.
BMC Complementary Medicine and Therapies, 2013/05
Free full text
3766

How do experiences of physiotherapy and osteopathy vary between NHS and private practice?
Bradbury, K.
Unpublished PhD thesis, 2013/05
Free full text
3767

Use of the SMART Balance Master to quantify the effects of osteopathic manipulative treatment in patients with dizziness
Fraix, M., Gordon, A., Graham, V., Hurwitz, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
3768

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
3769

An osteopathic approach to gastrointestinal disease: somatic clues for diagnosis and clinical challenges associated with Helicobacter pylori antibiotic resistance
Smilowicz, A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
3770

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text
3771

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05
3772

La prise en charge medicale et osteopathique de l'enuresie nocturne primalre isolee.
(The medical and osteopathic management of isolated primary nocturnal enuresis)
Burguete, E., Dubois, T.
Soins Pédiatrie/Puériculture, 2013/05
3773

Manual Therapy May Benefit Women With Primary Dysmenorrhea
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3774

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3775

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3776

Im Gespräch mit … François Corfù
(In dialog with François Corfù)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
3777

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text
3778

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3779

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3780

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3781

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3782

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text
3783

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3784

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3785

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3786

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3787

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3788

Ohio osteopathic residency directors' self-reported administrative knowledge and skills before and after participation in an administrative training program
Sheehan, O. O., Brannan, G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
3789

The effects of experience on the inter-reliability of osteopaths to detect changes in posterior superior iliac spine levels using a hidden heel wedge
Sutton, C., Nono, L., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/04
3790

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text
3791

Clinical decision making and therapeutic approaches of experienced osteopaths
Thomson, O.
Unpublished PhD thesis, 2013/04
Free full text
3792

Developing a chronic pain self-management clinic at the British School of Osteopathy: Quantitative pilot study results
Abbey, H., Nanke, L.
International Journal of Osteopathic Medicine, 2013/03
3793

Evaluation of behavioural and gastrointestinal symptoms in autistic children after visceral osteopathic treatment
Castellarin, I. B., Drysdale, I. P., Patel, V.
International Journal of Osteopathic Medicine, 2013/03
3794

Is osteopathic manipulative treatment effective in migraine?
Cerritelli, F., Caprari, E., Di Vincenzo, M., Ginevri, L. R., Messi, G., Renzetti, C., Cozzolino, V., Frattesi, C., Barlafante, G., Foschi, N.
International Journal of Osteopathic Medicine, 2013/03
3795

Osteopathic principles in the modern world
Cotton, A.
International Journal of Osteopathic Medicine, 2013/03
3796

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
3797

Profiling osteopathic practice in the UK using standardised data collection
Fawkes, C. A., Leach, J. M. C., Mathias, S., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
3798

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03
3799

From distinct to indistinct, the life cycle of a medical heresy. Is osteopathic distinctiveness an anachronism?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2013/03
3800

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03
3801

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03
3802

An historical perspective on principles of osteopathy
Stark, J. E.
International Journal of Osteopathic Medicine, 2013/03
3803

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
3804

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
3805

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03
3806

Osteopathie im Kontext der italienischen Politik
(Osteopathy in the context of Italian politics)
Tozzi, P.
Osteopathische Medizin, 2013/03
3807

Osteopathische Aspekte der Haltungsasymmetrie des Säuglings – eine funktionelle Betrachtung
(Osteopathic aspects of infantile postural asymmetry – A functional examination)
Riedel, M.
Osteopathische Medizin, 2013/03
3808

Enuresis als Folge eines erhöhten Drucks in den Kavitäten – ein Fallbeispiel
(Enuresis as a consequence of an increased pressure in the cavities – A case study)
Klein, M.
Osteopathische Medizin, 2013/03
3809

Gehirn und Osteopathie – Kongress der Osteopathie Schule Deutschland in Berlin
(Brain and osteopathy – Congress of the Osteopathy School Germany in Berlin)
Goldenstein, R.
Osteopathische Medizin, 2013/03
3810

Untersuchung des Einflusses der Osteopathie auf das obstruktive Schlafapnoesyndrom
(Study of the influence of osteopathy on obstructive sleep apnea syndrome)
Dahlke, J.
Osteopathische Medizin, 2013/03
3811

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Minotti, D. E., Gatchel, R. J., Kearns, C. M., Singh, K. P.
Annals of Family Medicine, 2013/03
Free full text
3812

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03
3813

An Exploration of Emerging Professional Identity in Women Osteopathic Medical Students: Does Gender Matter?
Dunatov, L. J.
Unpublished Dissertation, 2013/03
3814

Effect of osteopathic manipulative treatment on incidence of postoperative ileus and hospital length of stay in general surgical patients
Baltazar, G. A., Betler, M. P., Akella, K., Khatri, R., Asaro, R., Chendrasekhar, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
3815

Somatic hygiene: osteopathic manipulative medicine as preventive treatment
Bowers, R. J.
The Journal of the American Osteopathic Association, 2013/03
Free full text
3816

Osteopathic manipulative treatment for colonic inertia
Cohen-Lewe, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
3817

Osteopathic manipulative treatment for Lyme disease-induced Bell’s palsy: A case study
Baker, J. P., Baker, C. D.
The AAO Journal, 2013/03
Free full text
3818

Evaluating teaching methods and assessment tools of high velocity low amplitude techniques for undergraduate osteopathic manipulative treatment of the spine
Channell, M. K.
The AAO Journal, 2013/03
Free full text
3819

Osteopathic manipulative treatment of pes anserine bursitis using the triple technique: A case report
Chmielewski, R., Peña, N., Capalbo, G.
The AAO Journal, 2013/03
Free full text
3820

Sensory integration syndrome or developmental coordination disorder: A case report
Crow, T.
The AAO Journal, 2013/03
Free full text
3821

Gait disturbance in the elderly: Contribution of an osteopathic treatment
Huard, Y.
The AAO Journal, 2013/03
Free full text
3822

Normalization of thoracoabdominal fascial and autononic tone: A case study for the diagnosis and treatment of atypical chest pain
Litman, R. G.
The AAO Journal, 2013/03
Free full text
3823

Sequelae of traumatic closed-head injury: A case report of a 71-year-old male seen forty years later
Litman, R. G.
The AAO Journal, 2013/03
Free full text
3824

‘POSTE’ study (Patients OSTeopathic Experience): A UK national survey of patients: Part III
Drysdale, I. P., Rolfe, K. J., Hinkley, H.
International Journal of Osteopathic Medicine, 2013/03
3825

Patients' expectations of private osteopathic care in the UK: A national survey of patients
Leach, J. M. C., Mandy, A., Cross, V., Fawkes, C. A., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
3826

Langzeiteffekte osteopathischer Behandlungen bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom : 5-Jahres-Follow-up einer randomisiert kontrollierten Studie und Uberlegungen zum pathophysiologischen Kontext.
(Long-term effects of osteopathic treatment of chronic prostatitis with chronic pelvic pain syndrome: a 5-year follow-up of a randomized controlled trial and considerations on the pathophysiological context)
Marx, S., Cimniak, U., Rutz, M., Resch, K.L.
Urologe A, 2013/03
3827

OMT: Reducing Pain and Changing International Patient Perception
Lim, L., Gordon, T., Sergent, S., Hawkins, J., Simon, J., Bajoka, B., Favazza, L., Wiseman, K., Schrotenboer, A., Cameroamortegui, F., Willyerd, G., Gorbis, S.
The Journal of the American Osteopathic Association, 2013/03
3828

Achieving Effective and Efficient Musculoskeletal Pain Relief Through TCM and OMM
Moy, C., Yu, J., Chiu, R., Hwang, Y. C., Lin, W., Lin, S.L., Burns, J., Lin, A.
The Journal of the American Osteopathic Association, 2013/03
3829

Neoplasmas ósseos e osteopatia hipertrófica em cães
(Bone neoplasms and hypertrophic osteopathy in dogs)
Trost, M. E.
Unpublished Dissertation, 2013/02
Free full text
3830

Referrals to chiropractors and osteopaths: a survey of general practitioners in rural and regional New South Wales, Australia
Wardle, J. L., Sibbritt, D. W., Adams, J.
Chiropractic & Manual Therapies, 2013/02
Free full text
3831

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02
3832

Strain-counterstrain to treat restrictions of the mobility of the cervical spine in patients with neck pain: a sham-controlled randomized trial
Klein, R., Bareis, A., Schneider, A., Linde, K.
Complementary Therapies in Medicine, 2013/02
Free full text
3833

Charakteristik von Nebenwirkungen, die im Rahmen der Osteopathieausbildung bei Studenten auftreten (im Vergleich zu Nebenwirkungen, die im Rahmen der Chiropraxisausbildung auftreten)
(Adverse events sustained by osteopathic students during their undergraduate training at an osteopathic school (compared with adverse events sustained by chiropractic students during their undergraduate training))
Steger, S.
Unpublished MSc thesis, 2013/02
3834

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text
3835

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
3836

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
3837

Efeitos da técnica de strain-counterstrain sobre os músculos mastigatórios em mulheres com disfunção temporomandibular
(Effects of strain-counterstrain technique in masticatory muscles of women with temporomandibular disorder: a randomized double-blind placebo-controlled trial)
Stefanelli, V. C.
Unpublished MSc thesis, 2013/02
Free full text
3838

Fracture healing with osteopathy in traditional Mongolian medicine
Zhao, N., Wang, M., Li, X.
Journal of Traditional Chinese Medicine, 2013/02
Free full text
3839

Headache in children: update on complementary treatments
Schetzek, S., Heinen, F., Kruse, S., Borggraefe, I., Bonfert, M., Gaul, C., Gottschling, S., Ebinger, F.
Neuropediatrics, 2013/02
Free full text
3840

Comparison of gait training versus cranial osteopathy in patients with Parkinson's disease: a pilot study
Muller, T., Pietsch, A.
NeuroRehabilitation, 2013/02
3841

Exercise Shown Effective for Management of Neck Pain—Who Needs OMT?
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3842

Visceral Manipulation May Affect Pain Perception
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3843

Frozen Shoulder Treatment—Different Strokes for Different Folks
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3844

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3845

Polytrauma durch Motorradunfall
(Polytrauma due to motorcycle accident)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3846

Osteopathic Fascial Manipulation Reduces Low Back Pain and Increases Kidney Mobility
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3847

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3848

Die Rolle des Diaphragmas bei der lymphatischen Absorption aus der Peritonealhöhle
(The role of the diaphragm in lymphatic absorption from the peritoneal cavity)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3849

Im Gespräch mit … Tom Shaver
(In dialog with Tom Shaver)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3850

Der Einfluss einer manipulativen Technik auf den Occiput-Atlas-Axis-Komplex (OAA) im Vergleich zu einer lokalen Wärmebehandlung des OAA-Bereiches auf die habituelle Okklusion
(The influence of manipulative treatment of the Occiput Atlas Axis (OAA) Complex in comparison to a local heat application of the OAA Complex on habitual occlusion)
Haase, H.
Unpublished MSc thesis, 2013/01
3851

Untersuchung der Wirksamkeit der Osteopathie im Rahmen der gesundheitsbedingten Lebensqualität im Wochenbett
(Investigating the efficacy of Osteopathy in Childbed - regarding the health related quality of life of the mothers)
Dlugos, J. M.
Unpublished MSc thesis, 2013/01
Free full text
3852

Beschwerden in der Schwangerschaft – Kann Osteopathie die Lebensqualität beeinflussen?
(Complaints during pregnancy – Can osteopathy influence the patient’s quality of life?)
Göttlich, G.
Unpublished MSc thesis, 2013/01
Free full text
3853

Osteopathic manipulative treatment (OMT) for lower urinary tract symptoms (LUTS) in women
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2013/01
3854

A new look for the Journal of the American Osteopathic Association
Berneath Lang, D., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3855

Evidencia científica del movimiento respiratorio primario y su aceptación en las diferentes escuelas de osteopatía del mundo
(Scientific evidence of the primary respiratory movement and its acceptance in the different osteopathic schools of the world)
Caicedo Ocampo, M. d. P.
Unpublished MSc thesis, 2013/01
Free full text
3856

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3857

Die Rolle der Osteopathie im Umgang mit Trauma – ein persönlicher Bericht
(The role of osteopathy in dealing with trauma - a personal account)
Brown, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3858

Empatía en médicos con experiencia en Medicina Alternativa
(Empathy in physicians with experience in Alternative Medicine)
Hernández Vela, S.
Unpublished MSc thesis, 2013/01
Free full text
3859

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3860

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3861

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01
3862

Manual therapy for childhood respiratory disease: a systematic review
Pepino, V. C., Ribeiro, J. D., Ribeiro, M. A., de Noronha, M., Mezzacappa, M. A., Schivinski, C. I.
Journal of Manipulative and Physiological Therapeutics, 2013/01
3863

Investigating inter-relationships between pain, mobility, and posture following osteopathic treatment in patients with chronic neck pain
Frith, K. L.
Unpublished MSc thesis, 2013/01
Free full text
3864

Use of OMT in Recreational Runners as Preventive Medicine
Daly, J., Zhu, C., Hanna, J.
The Journal of the American Osteopathic Association, 2013/01
3865

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3866

Survey of Patient Knowledge of Osteopathic Physicians and Osteopathic Manipulative Treatment
Snell, P. D., AbdurRaqeeb, O. A., Smith, T. L., Huckabee, M. M., Keenum, A.
The Journal of the American Osteopathic Association, 2013/01
3867

Thermographic Skin Measurement and Osteopathic Palpation of Tibial Interosseous Strains in Adults A Comparative Pilot Study.
Muntinga, E.
Unpublished D.O. thesis, 2013
3868

A six year head-to-head comparison of osteopathic and allopathic applicants to a university-based, allopathic general surgery residency
Schlitzkus, L. L., Clark, C. J., Agle, S. C., Schenarts, P. J.
Journal of Surgical Education, 2012/12-11
Free full text
3869

An investigation of cranial motion through a review of biomechanically based skull deformation literature
Seimetz, C. N., Kemper, A. R., Duma, S. M.
International Journal of Osteopathic Medicine, 2012/12
3870

Manual therapy for chronic obstructive airways disease: a systematic review of current evidence
Heneghan, N. R., Adab, P., Balanos, G. M., Jordan, R. E.
Manual Therapy, 2012/12
Free full text
3871

Nouvelle technique passive d’ouverture de la trompe d’Eustache. Évaluation par tympanométrie de l’effet d’une nouvelle manipulation sur l’ouverture de la trompe d’Eustache chez les enfants de moins de six ans atteints d’une otite moyenne avec ou sans effusion
(New passive technique for opening the Eustachian tube. Evaluation by tympanometry of the effect of a new manipulation on the opening of the Eustachian tube in children under six years of age with otitis media with or without effusion)
El Hachem, N., Halimi, M.
Kinésithérapie, la Revue, 2012/12
Free full text
3872

Osteopathic diagnosis and treatment of sacral fracture: A case study
Dean, A. L.
The AAO Journal, 2012/12
Free full text
3873

Konferenz der Osteopathic International Alliance 2012 in Paris
(Conference of the Osteopathic International Alliance, Paris 2012)
Mayer, J.
Osteopathische Medizin, 2012/12
3874

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12
3875

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12
3876

Osteopathische manuelle Behandlung von Scharlach bei Kindern im 19. und 20. Jahrhundert
(Osteopathic manual treatment of scarlet fever in children in the 19th and 20th centuries)
Liem, T., Ciranna-Raab, C.
Osteopathische Medizin, 2012/12
3877

Interview mit Theodor Dierk Petzold über Salutogenese und Osteopathie
(Interview with Theodor Dierk Petzold on salutogenesis and osteopathy)
Petzold, T. D.
Osteopathische Medizin, 2012/12
3878

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12
3879

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12
3880

VOD-Kongress 2012 in Weimar – „The Embryo and the Health”
(Weimar's 2012 VOD-Congress - 'The Embryo and the Health')
Risch, A. J.
Osteopathische Medizin, 2012/12
3881

Manipulative therapies for infantile colic
Dobson, D., Lucassen, P. L., Miller, J. J., Vlieger, A. M., Prescott, P., Lewith, G.
Cochrane database of systematic reviews, 2012/12
Free full text
3882

Craniosacral therapy: a systematic review of the clinical evidence
Ernst, E.
Focus on Alternative and Complementary Therapies, 2012/12
3883

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3884

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3885

Electronic Medical Records Adoption and Usage Among Osteopathic Physicians in New York State
Rosenthal, J. I.
Unpublished PhD thesis, 2012/12
3886

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3887

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3888

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3889

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3890

Touch - more than a basic science
Lalonde, F.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3891

Manipulation of the coccyx with anesthesia for the management of coccydynia
Emerson, S. S., Speece III., A. J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3892

The effect of osteopathic manual therapy on the vascular supply to the lower extremity in individuals with knee osteoarthritis: A randomized trial
Jardine, W. M., Gillis, C., Rutherford, D.
International Journal of Osteopathic Medicine, 2012/12
3893

A research protocol to determine if OMM is effective in decreasing pain in chronic pain patients and decreasing opioid use: Brief report
Smith, J. B., Ridpath, L. C., Steele, K. M.
The AAO Journal, 2012/12
Free full text
3894

Investigation into the role subject foot position has on the assessment of the Seated Flexion Test and a test of inter-rater reliability
Silva, M. J., Boudakian, C., Hruby, R.
The AAO Journal, 2012/12
Free full text
3895

Isolated calcaneofibular ligament injuries treated with osteopathic manipulative treatment: A case series
Olds, K., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/12
3896

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3897

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3898

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3899

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3900

Complementary and Alternative Therapies in Surgical Care
Bjerså, K.
Unpublished PhD thesis, 2012/11
Free full text
3901

Osteopathic manipulative treatment: much more than simply a “hands-on“ phenomenon
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3902

Die osteopathische Behandlung von Frauen mit Gebärmuttersenkung. Randomisierte kontrollierte Studie.
(Osteopathic treatment of women with pelvic organ prolapse. A randomized controlled trial)
Amendt, J., Thannheimer, Y.
Unpublished D.O. thesis, 2012/10
3903

Die möglichen Effekte von osteopathischen Behandlungen bei komatösen Patienten mit erhöhtem Hirndruck
(Possible effects of osteopathic treatments in comatose patients with intracranial hypertension. Exploratory Observational Study)
Arens, O., Blum, A., Braun, S.
Unpublished D.O. thesis, 2012/10
3904

Bemerkenswerte Fortschritte bei behinderten Patienten durch „evolutionäre Osteopathie“
(Remarkable progress in disabled patients through “evolutionary osteopathy“)
Deslee, E., Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3905

Einfluss der osteopathischen Behandlung auf die Lebensqualität von Kindern und Jugendlichen mit Asthma. Prä-Post Studie.
(The influence of osteopathic treatment on quality of life in children and adolescents with asthma. A pre-post study)
Berning, F., Hagoort, J.
Unpublished D.O. thesis, 2012/10
3906

Effektivität der osteopathischen Behandlung bei Patienten mit „Trockenem Auge“. Randomisierte kontrollierte Studie.
(The effectiveness of osteopathic treatment in patients suffering from dry eye disease (DED). A randomized controlled study)
Biwer, A.
Unpublished D.O. thesis, 2012/10
3907

Osteopathische Behandlung von Patienten mit Restless-Legs-Syndrom. Randomisierte kontrollierte Studie.
(Osteopathic treatment of patients with restless legs syndrome. Randomized controlled trial)
Bonacker, M., Gabriel, S., Ruchser, J.
Unpublished D.O. thesis, 2012/10
3908

Why reservations remain: a critical reflection about the systematic review and meta-analysis “Osteopathic manipulative treatment for low back pain“ by Licciardone et al
Franke, H.
Journal of Bodywork and Movement Therapies, 2012/10
3909

(Evaluation of the Effectiveness of Osteopathic Treatment on Cholesterol Levels in Patients Suffering from Hypercholesterolemia. A randomized controlled study)
Eggers, G.
Unpublished D.O. thesis, 2012/10
3910

Die Auswirkungen von osteopathischen Behandlungen bei Patient/innen mit dem Fibromyalgiesyndrom. Prä-Post Studie.
(Osteopathic treatment effects in patients with fibromyalgia. Pre-Post Study)
Gleich, A., Klein, C., Sheriff, S.
Unpublished D.O. thesis, 2012/10
Free full text
3911

(Osteopathic treatment of patients with shoulder pain. A randomized controlled study)
Hinse, T., Klosterkamp, M.
Unpublished D.O. thesis, 2012/10
3912

Können osteopathische Behandlungen die Symptomatik sowie die Häufigkeit des chronischen Spannungskopfschmerzes verbessern? Randomisierte kontrollierte Studie.
(Can osteopathic treatments improve the symptoms and the frequency of Chronic Tension-Type headache (CTTH)? A randomized controlled trial)
Koralewski, D., Kothe, M., Schröter, C.
Unpublished D.O. thesis, 2012/10
3913

Evaluation der Interindividuellen Reliabilität eines osteopathischen Gewebetests (Gesamtgewebe-Restriktions-Tests/All Tissue Tension Test). Eine diagnostische Studie.
(The All Tissue Tension Test (A Triple T): Evaluation of Interrater Reliability. Diagnostic Study)
Krieger, A., Roggendorf, M.
Unpublished D.O. thesis, 2012/10
3914

Wirkung von osteopathischen Behandlungen bei Kindern mit Rechenstörungen in der 3. Klasse Grundschule. Eine randomisierte kontrollierte Studie.
(To evaluate the effectiveness of osteopathic treatment in 3rd elementary school class children suffering from dyscalculia. A randomized controlled trial)
Nickels-Kratz, K.
unpublished D.O. thesis, 2012/10
3915

Über die Ursprünge der Biodynamik in der Osteopathie. Sind Grundzüge des Biodynamischen Gedankengutes schon in den Aussagen von A. T. Still zu finden? Eine historische Literaturübersicht
(The origins of biodynamics in osteopathy. Can principles of biodynamic ideas already be detected in statements of A.T. Still? Basic Research)
Roth, R.
Unpublished D.O. thesis, 2012/10
3916

Die osteopathische Behandlung bei Frauen mit persistierenden Rückenschmerzen post partum. Randomisierte kontrollierte Studie.
(Osteopathic treatment in women with persistent low back pain after childbirth. A randomized controlled trial)
Rother, D., Rother, K.
Unpublished D.O. thesis, 2012/10
3917

Die Beweglichkeit des Dünndarms bei In- und Exspiration
(The mobility of the small intestine during inspiration and expiration)
Schröter, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3918

Wirksamkeit osteopathischer Behandlungen bei Kindern mit habitueller, idiopathischer Epistaxis. Randomisierte kontrollierte Studie
Effectiveness of osteopathic treatment in children with . A randomized controlled trial.
Bergau, R, Strunk, A
Unpublished D.O. thesis, 2012/10
3919

Im Gespräch mit … Carol Trowbridge
(In conversation with Carol Trowbridge)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3920

The immediate effects of sigmoid colon manipulation on pressure pain thresholds in the lumbar spine
McSweeney, T. P., Thomson, O. P., Johnston, R.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text
3921

971 Neonatology-Osteopathy (Ne-O) Study: RCT on the Effect of Osteopathic Manipulative Treatment on Los
Accorsi, A., Lucci, C., Pizzolorusso, G., Tubaldi, L., Cerritelli, F., Perri, F. P.
Archives of Disease in Childhood, 2012/10
3922

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text
3923

Geographic patterns in primary care visits provided by osteopathic physicians
Licciardone, J. C.
Family Medicine, 2012/10
3924

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10
3925

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text
3926

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text
3927

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text
3928

Die physiologische Entwicklung in den ersten Lebensjahren
(The physiological development in the first years of life)
Guerassimiouk, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3929

Consent in osteopathy: A cross sectional survey of patients' information and process preferences
Daniels, G., Vogel, S.
International Journal of Osteopathic Medicine, 2012/09
3930

Osteopathic manipulative treatment of somatic dysfunction as an integral component in the care of patients with chronic medical disease: A thirty-month study in rural Appalachia
Litman, R. G.
The AAO Journal, 2012/09
Free full text
3931

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09
3932

An open letter to those in purely osteopathic manipulative medicine practices on reimbursement strategies
Jorgensen, D. J.
The AAO Journal, 2012/09
3933

Follow-up to: OMT and exercises for a patient with limited knee range of motion prior to knee replacement: A case report
Clark, R. C.
The AAO Journal, 2012/09
Free full text
3934

Using manual and conventional therapies to enhance musculoskeletal health: highlights of the Osteopathic Research Center's 10th Anniversary Conference
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3935

WSO feiert 20-jähriges Bestehen mit Sommerfest und Sommerakademie
(The Vienna School of Osteopathy (WSO) celebrates 20th year of existence with summer festival and summer academy)
Risch, A. J.
Osteopathische Medizin, 2012/09
3936

Metaphern für Gesundheit – Gesundheit als Metapher
(Metaphors for health - Health as metaphor)
Risch, A. J.
Osteopathische Medizin, 2012/09
3937

Funktionsstörungen des Ösophagus und des gastro-ösophagealen Übergangs: Techniken zur Behandlung
(Functional disorders of the esophagus and esophagogastric junction: Techniques for the treatment)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2012/09
3938

Interview mit Jane Stark über die biografischen Quellen der Osteopathie
(Interview with Jane Stark on the biographical sources of osteopathy)
Stark, J.
Osteopathische Medizin, 2012/09
3939

Osteopathie bei Infantiler Zerebralparese – Pilotstudie Kann durch craniale Behandlung ein positiver Effekt auf die Gelenksbeweglichkeit bei Infantiler Zerebralparese erzielt werden?
(Osteopathic Treatment in Cases of Infantile Cerebral Palsy – Pilot Study Does cranial treatment achieve a positive effect on joint mobility in cases of infantile cerebral palsy?)
Palko, P.
Unpublished MSc thesis, 2012/09
Free full text
3940

Die Anamnese in der Osteopathie - Theorie und Praxis
(Case History Taking in Osteopathy - Theory and Practice)
Mena, J. E.R.
Unpublished MSc thesis, 2012/09
Free full text
3941

Osteopathie und ihre Effektivität bei Fasciitis plantaris
(Osteopathy and its effectiveness in fasciitis plantaris)
Burmeister, S.
Unpublished MSc thesis, 2012/09
Free full text
3942

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text
3943

Einfluss der osteopathischen Behandlung auf die Blutdruckwerte bei Patienten mit essentieller arterieller Hypertonie
(Influence of Osteopathic Treatment on Blood Pressure Values of Patients with Essential Arterial Hypertension)
Wasserfaller, A.
Unpublished MSc thesis, 2012/09
Free full text
3944

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3945

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3946

Associations of cytokine concentrations with key osteopathic lesions and clinical outcomes in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Bergamini, M. V.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3947

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3948

Precompetition manipulative treatment and performance among Virginia Tech athletes during 2 consecutive football seasons: a preliminary, retrospective report
Brolinson, P. G., Smolka, M., Rogers, M., Sukpraprut, S., Goforth, M. W., Tilley, G., Doolan, K. P.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3949

Neuropathy of the inferior alveolar nerve: A case report
Seals, R. A., Crow, T.
The AAO Journal, 2012/09
Free full text
3950

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text
3951

Synergopathic medicine and the cranial concept in the successful treatment of a patient with acute paralytic ileus: A case report
Pribadi, K. S.
The AAO Journal, 2012/09
Free full text
3952

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3953

What puts the adverse in 'adverse events'? Patients' perceptions of post-treatment experiences in osteopathy - a qualitative study using focus groups
Rajendran, D., Bright, P., Bettles, S., Carnes, D., Mullinger, B.
Manual Therapy, 2012/08
3954

Health-related Internet use among patients of osteopathic physicians
Cooley, D. L., Mancuso, A. M., Weiss, L. B., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3955

Osteopathy improves the severity of irritable bowel syndrome: a pilot randomized sham-controlled study
Florance, B. M., Frin, G., Dainese, R., Nebot-Vivinus, M. H., Marine Barjoan, E., Marjoux, S., Laurens, J. P., Payrouse, J. L., Hebuterne, X., Piche, T.
European Journal of Gastroenterology & Hepatology, 2012/08
Free full text
3956

Psoas syndrome: a frequently missed diagnosis
Tufo, A., Desai, G. J., Cox, W. J.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3957

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3958

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3959

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3960

Neonatology-Osteopathy (NE-O) Study: A Randomized Controlled Trial on the Effect of Osteopathic Manipulative Treatment on Length of Stay
Accorsi, A., Lucci, C., Lancellotti, J., Pizzolorusso, G., Santini, N., Durastanti, C., Barlafante, G., Tubaldi, L., Perri, F. P., Cerritelli, F.
The Journal of the American Osteopathic Association, 2012/08
3961

Communicating About Osteopathic Medicine: An Analysis of Osteopathic Residents’ Responses to the Question “What’s the Difference Between a DO and an MD?”
Hamstra, J.
The Journal of the American Osteopathic Association, 2012/08
3962

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3963

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08
3964

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08
3965

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3966

Acute Effects of Osteopathic Manipulative Treatment on Persistent Hindlimb Flexion
Winterson, B., McDevitt Ray, B., Assadollahzadeh, M., Chipman, M. A.
The Journal of the American Osteopathic Association, 2012/08
3967

Burnout Among Osteopathic Otolaryngology Residents: Identification, Prevention, and Treatment During Formative Training Years
Yost, M., Johnson, J. C., Burchett, K.
The Journal of the American Osteopathic Association, 2012/08
3968

Putting on White Coats: Professional Socialization of Medical Students Through Narrative Pedagogy in Standardized Patient Labs
Patterson, S. D.
Unpublished PhD thesis, 2012/08
Free full text
3969

Quels traitements pour les coliques du nourrisson?
(Which treatments for infantile colics?)
Bruyas-Bertholon, V., Lachaux, A., Dubois, J.P., Fourneret, P., Letrilliart, L.
La Presse Médicale, 2012/07-08
3970

Selbst anzuwendende Übungen für Patienten im osteopathischen Kontext
(Home-based exercises for patients in the osteopathic context)
Resch, A.
Unpublished MSc thesis, 2012/07
Free full text
3971

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3972

Im Gespräch mit … Myriam Vleminckx
(In dialog with Myriam Vleminckx)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3973

„Sacral Sag“ und mögliche klinische Folgen
(“Sacral Sag“ and possible clinical consequences)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3974

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3975

Increase of lower esophageal sphincter pressure after osteopathic intervention on the diaphragm in patients with gastroesophageal reflux
da Silva, R. C., de Sa, C. C., Pascual-Vaca, A. O., de Souza Fontes, L. H., Herbella Fernandes, F. A., Dib, R. A., Blanco, C. R., Queiroz, R. A., Navarro-Rodriguez, T.
Diseases of the Esophagus, 2012/07
Free full text
3976

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3977

Kreuzschmerzen während der Schwangerschaft
(Low back pain during pregnancy)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3978

Osteopathic manipulative treatment to resolve head and neck pain after tooth extraction
Meyer, P. M., Gustowski, S. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3979

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3980

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3981

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3982

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3983

The safety and efficacy of osteopathic manipulation in the treatment of mTBI (mild traumatic brain injury) in U.S. service members as validated by SPECT scan: A report of planned research
Nevins, N. A., Fraix, M.
The AAO Journal, 2012/06
Free full text
3984

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
3985

Bericht über die AAO-Convocation 2012 in Louisville
(Report of the AAO-Convocation, Louisville 2012)
Osteopathische Medizin, 2012/06
3986

Interview mit Jaap van der Wal über die Embryologie und ihre Bedeutung für die Osteopathie
(Interview with Jaap van der Wal on embryology and its significance for osteopathy)
van der Wal, J.
Osteopathische Medizin, 2012/06
3987

Osteopathic physicians and international medical graduates in the rural primary care physician workforce
Fordyce, M. A., Doescher, M. P., Chen, F. M., Hart, L. G.
Family Medicine, 2012/06
3988

Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Malinska, J., Golusinski, W., Sliwinska-Kowalska, M.
International Journal of Occupational Medicine and Environmental Health, 2012/06
3989

Osteopathic manipulative medicine for carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3990

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3991

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3992

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3993

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3994

Application of osteopathic manipulative treatment to a patient with unremitting chest pain and shortness of breath undergoing “Rule-Out Myocardial Infarction” protocol for one week
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/06
3995

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3996

Letter About “Thanks, but No Thanks: How Denial of Osteopathic Service in the World Wars Shaped the Profession–1”
Stiger, J.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3997

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3998

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3999

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
4000

Osteopathic treatment of chronic gonalgia in the elderly: Changes in pain and posture
Huard, Y.
The AAO Journal, 2012/04
Free full text
4001

Kopfschmerzen: Behandlung nach dem Fasziendistorsionsmodell
(Headache: treatment according to the fascial distortion model)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
4002

Im Gespräch mit … Lorenz Wilkens
(In dialog with Lorenz Wilkens)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
4003

Assessment of Low Back and Pelvic Pain after applying the Pelvis Global Manipulation Technique in Patients with Primary Dysmenorrhea: A Pilot Study
Molins-Cubero, S., Boscá-Gandia, J. J., Rus-Martinez, M. A.
European Journal Osteopathy & Related Clinical Research, 2012/04
Free full text
4004

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
4005

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text
4006

Wie Vorstellungen die Beschwerden der Patienten beeinflussen
(How beliefs influence patient discomforts)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
4007

Dysfunktionen der Faszien als beschwerdeunterhaltender Faktor
(Dysfunctions of the fascia as a complaint-sustaining factor)
Forner, K.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
4008

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
4009

Prediction of Osteopathic Medical School Performance on the basis of MCAT score, GPA, sex, undergraduate major, and undergraduate institution
Dixon, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
4010

What’s in a Name? A Brief Look at the History of Board Certification in Neuromusculoskeletal Medicine and Osteopathic Manipulative Medicine
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
4011

Redirect terminology debate toward improved definition of osteopathic medicine
Ching, L. M.
The Journal of the American Osteopathic Association, 2012/03
Free full text
4012

Wasser, Licht, Luft, Eis und das 16. Europäische Symposium der Traditionellen Osteopathie
(Report: Water, light, air, ice and the 16th European Symposium of Traditional Osteopathy)
Vellmer, S.
Osteopathische Medizin, 2012/03
4013

Interview mit Prof. Matthias Beck, AVT-College, Nagold
(Interview with Prof. Matthias Beck, AVT-College, Nagold)
Beck, M.
Osteopathische Medizin, 2012/03
Free full text
4014

Osteopathische Therapie in der Migränebehandlung: eine randomisierte kontrollierte Studie über die Wirksamkeit
(Osteopathic medicine: Osteopathic therapy in the treatment of migraine: A randomized controlled study about the effectiveness)
Burmeister, U., Beck, M., Voigt, K., Liebnitzky, J., Bergmann, A.
Osteopathische Medizin, 2012/03
4015

Interview mit Christian Ciranna-Raab, Osteopathie Schule Deutschland
(Interview with Christian Ciranna-Raab, Osteopathische Schule Deutschland)
Ciranna-Raab, C.
Osteopathische Medizin, 2012/03
Free full text
4016

Interview mit Prof. Dietmar Daichendt, Hochschule für Gesundheit und Sport
(Interview with Prof. Dietmar Daichendt, University for Health and Sports)
Daichendt, D.
Osteopathische Medizin, 2012/03
Free full text
4017

Interview mit Raimund Engel, Donau Universität Krems
(Interview with Raimund Engel, Danube University Krems)
Engel, R.
Osteopathische Medizin, 2012/03
Free full text
4018

Interview mit Marina Fuhrmann, Hochschule Fresenius, Idstein
(Interview with Marina Fuhrmann, Hochschule Fresenius, Idstein)
Fuhrmann, M.
Osteopathische Medizin, 2012/03
Free full text
4019

Interview mit Dr. med. Bernhard Hartwig, IKT, München
(Interview with Dr. med. Bernhard Hartwig, IKT, Munich)
Hartwig, B.
Osteopathische Medizin, 2012/03
Free full text
4020

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03
4021

Osteopathiestudium in Deutschland und Österreich
(Osteopathy studies in Germany and Austria)
Newiger, C.
Osteopathische Medizin, 2012/03
4022

Kopfschmerzbehandlung – Gedanken aus dem Praxisalltag
(Practice and technique: Treatment of headache - Thoughts from the practical daily routine)
Unverricht, R.
Osteopathische Medizin, 2012/03
4023

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03
4024

Interview mit Claudia Wiederin, fhg, Innsbruck
(Interview with Claudia Wiederin, fhg, Innsbruck)
Wiederin, C.
Osteopathische Medizin, 2012/03
Free full text
4025

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03
4026

Chiropractic or Osteopathic Manipulation for Children in the United States: An Analysis of Data from the 2007 National Health Interview Survey
Ndetan, H., Evans, M. W., Hawk, C., Walker, C.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text
4027

Stress reduction with osteopathy assessed with GDV electrophotonic imaging: effects of osteopathy treatment
Korotkov, K., Shelkov, O., Shevtsov, A., Mohov, D., Paoletti, S., Mirosnichenko, D., Labkovskaya, E., Robertson, L.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text
4028

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text
4029

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
4030

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text
4031

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text
4032

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text
4033

Anterior hip pain – Have you considered femoroacetabular impingement?
Chakraverty, J. K., Snelling, N. J.
International Journal of Osteopathic Medicine, 2012/03
4034

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
4035

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text
4036

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text
4037

„Was Sie machen, ist doch keine Osteopathie!“ – Ansätze zu einem konsensfähigen Selbstverständnis
(“What you are doing is not osteopathy after all!“ - Approaches to a consensual self-image)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4038

Wie viel Differenzialdiagnostik braucht die Osteopathie?
(How much differential diagnostics does osteopathy need?)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4039

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4040

Die ersten Tage der DO … Aus dem Nähkästchen geplaudert
(The first days of the DO - telling it all)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4041

Hat der Osteopath einen bestimmten Persönlichkeitstypus?
(What is the personality type of an osteopath?)
Och, V.
Unpublished MSc thesis, 2012/02
Free full text
4042

Über den Zugang von Osteopathen zu erwachsenen Patienten im neurologischen Bereich in Österreich
(About the access of osteopaths to adult patients in the neurological field in Austria)
Müntner, A.
Unpublished MSc thesis, 2012/02
Free full text
4043

Ankommen in der Gegenwart oder ist die Osteopathie noch zu retten?
(Arriving in the present or can osteopathy still be saved?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4044

A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel
Cruser d, A., Maurer, D., Hensel, K., Brown, S., White, K., Stoll, S.
Journal of Manual & Manipulative Therapy, 2012/02
4045

Osteopathische Einflussmöglichkeiten auf die fetale Kopfposition im mütterlichen Becken bei Erstgebärenden
(Osteopathic possibilities to influence the fetal head position in the maternal pelvis in primipara)
Wünsch, A.
Unpublished MSc thesis, 2012/02
Free full text
4046

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text
4047

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text
4048

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4049

Fasziendistorsionsmodell nach Typaldos im Routinebetrieb eines Ambulatoriums
(Fascial distortion model according to Typaldos in routine operation of an outpatient clinic)
Gallei, L.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4050

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
4051

Osteopathie und ihre Wirkung auf lumbale, diskogene Radikulopathien bei CT -gezielt periradikulär infiltrierten Patienten
(Osteopathy and its effect on lumbar radicular pain related to patients with CT-guided nerve root infiltrations)
Rachinger, J.
Unpublished MSc thesis, 2012/01
Free full text
4052

Osteopathie und Palpation – ein psychophysikalischer Hintergrund
(Osteopathy and Palpation – A Psychophysical Approach)
Larcher-Schleich, K.
Unpublished MSc thesis, 2012/01
Free full text
4053

Untersuchung des Einflusses der Osteopathie auf das obstruktive Schlafapnoesyndrom
(Examination of the influence of osteopathy on the Obstructive Sleep Apnoea Syndrome)
Dahlke, J.
Unpublished MSc thesis, 2012/01
Free full text
4054

Vergleichende Analyse der Curricula der Osteopathie Ausbildungen mit Masterabschluss an der European School of Osteopathy, ESO, Großbritannien und der Internationalen Schule für Osteopathie, WSO, Österreich
(A Comparative Analysis of the Curricula of the European School of Osteopathy, ESO, UK and the International School of Osteopathy, WSO, Austria leading to a Master‘s Degree)
Düpree, B.
Unpublished MSc thesis, 2012/01
Free full text
4055

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text
4056

Use of therapies other than disease-modifying agents, including complementary and alternative medicine, by patients with multiple sclerosis: a survey study
Stoll, S. S., Nieves, C., Tabby, D. S., Schwartzman, R.
The Journal of the American Osteopathic Association, 2012/01
Free full text
4057

Cranial osteopathic manipulative medicine's growing evidence base
King, H. H.
The Journal of the American Osteopathic Association, 2012/01
Free full text
4058

The immediate effect of osteopathic ‘rib raising’ technique on heart rate variability: a randomised sham controlled experiment
White, N.
Unpublished MSc thesis, 2012/01
Free full text
4059

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01
4060

A hypothesis to explain the palpatory experience and therapeutic claims in the practice of osteopathy in the cranial field
Hamm, D.
International Journal of Osteopathic Medicine, 2011/12
4061

Towards a more international community in osteopathy
Moran, R. W.
International Journal of Osteopathic Medicine, 2011/12
4062

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12
4063

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
4064

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
4065

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text
4066

Consulting parents about the design of a randomized controlled trial of osteopathy for children with cerebral palsy
Edwards, V., Wyatt, K., Logan, S., Britten, N.
Health Expectations, 2011/12
4067

Subjektive Krankheitstheorien bei Patienten mit lumbalem Rückenschmerz
(Subjective theories of illness of patients with low back pain)
Penger, S.
Unpublished MSc thesis, 2011/12
Free full text
4068

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12
4069

The 2011 Thomas L. Northup Memorial Lecture – A Road Less Traveled: Osteopathy’s Legacy, Osteopathic Medicine’s Challenge
Degenhardt, B. F.
The AAO Journal, 2011/12
Free full text
4070

Increasing the number of osteopathic graduate medical education programs–“The time has come…”
Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
4071

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text
4072

Interview mit Jean-Pierre Barral: „Nur das Gewebe weiß Bescheid“
(Interview with Jean-Pierre Barral: “only the tissue knows“)
Barral, J.P.
Osteopathische Medizin, 2011/12
4073

OMT and exercises for a patient with limited knee range of motion prior to knee replacement: A case report
Clark, R. C.
The AAO Journal, 2011/12
Free full text
4074

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
4075

Osteopathischer Herbstgenuss in Potsdam
(Autumn osteopathic enjoyment in Potsdam)
Prediger, G.
Osteopathische Medizin, 2011/12
4076

Perspectives on quality assurance methods – A comparison of osteopathic programmes in two countries: A pilot study
Michelson, H. C.
Unpublished MSc thesis, 2011/12
Free full text
4077

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12
4078

Kranialer rhythmischer Impuls: Ist die palpierte Frequenz abhängig von der Berufserfahrung der Untersucher?
(Cranial rhythmic impulse: Is the palpation frequency dependent on the professional experience of the examiner?)
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
Osteopathische Medizin, 2011/12
4079

Wirksamkeit einer osteopathischen Behandlung bei Kinetose
(Effectiveness of an osteopathic treatment of motion sickness)
Thiel, O. L.
Osteopathische Medizin, 2011/12
4080

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text
4081

Sociodemographic and geographic characteristics associated with patient visits to osteopathic physicians for primary care
Licciardone, J. C., Singh, K. P.
BMC Health Services Research, 2011/11
Free full text
4082

Exploring the impact of osteopathic treatment on cranial asymmetries associated with nonsynostotic plagiocephaly in infants
Lessard, S., Gagnon, I., Trottier, N.
Complementary Therapies in Clinical Practice, 2011/11
Free full text
4083

Einfluss der Osteopathie bei Patienten mit schichtarbeitsbedingten Schlafstörungen
(Influence of osteopathy on patients with shiftwork-caused sleep disorders)
Brübach, S.
Unpublished MSc thesis, 2011/11
Free full text
4084

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text
4085

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text
4086

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
4087

Promoting safe and efficacious vaccines for adults
Grogg, S. E.
The Journal of the American Osteopathic Association, 2011/10
Free full text
4088

Patienteninfo: Obstruktive Bronchitis im Kindesalter
(Patient information: Obstructive bronchitis in childhood)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
4089

Chronischer Schlafmangel aufgrund von Atmungsproblemen
(Chronic sleep deprivation due to respiratory problems)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
4090

Osteopathische Behandlung der Lungenentzündung: schneller gesund, weniger Komplikationen
(Osteopathic treatment of pneumonia: faster recovery, fewer complications)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
4091

Support for women in osteopathic medicine who breastfeed: a call for action
Pieh-Holder, K. L.
The Journal of the American Osteopathic Association, 2011/10
Free full text
4092

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text
4093

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
4094

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09
4095

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Melnick, A.
The Journal of the American Osteopathic Association, 2011/09
Free full text
4096

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text
4097

Ultrasonography-guided osteopathic manipulative treatment for a patient with thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2011/09
Free full text
4098

Hat eine Intervention an der Schädelbasis Einfluss auf das Prämenstruelle Syndrom?
(Does an intervention at the cranial base have an influence on premenstrual syndrome?)
Hödl, S.
Unpublished MSc thesis, 2011/09
Free full text
4099

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text
4100

Lebensqualitätssteigerung bei osteopathischer Behandlung
(Increased Quality of Life in Osteopathic Therapy)
Bordás, R.
Unpublished MSc thesis, 2011/09
Free full text
4101

Interrater-Reliabilität bei der Beurteilung der Körpersprache nach dem Fasziendistorsionsmodell (FDM)
(Interrater reliability in evaluating the body language based on the Fascial Distortion Model (FDM))
Anker, S.
Unpublished MSc thesis, 2011/09
Free full text
4102

Das autonome Nervensystem in der Osteopathie: Überblick über die therapeutischen Optionen
(The autonomic nervous system in osteopathy: Overview of therapeutic options)
Beck, A.K.
Osteopathische Medizin, 2011/09
4103

Neubewertung der klassischen osteopathischen Feldtheorie am Beispiel von Perzeption und Wahrnehmung
(Reevaluation of the classic osteopathic field theory using perception and cognition as example)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/09
4104

Situation der Osteopathie in Frankreich
(Situation of osteopathy in France)
Steringot, P.
Osteopathische Medizin, 2011/09
4105

Zahnmedizinische Begriffe für Osteopathen – eine Einführung
(Dental concepts for osteopaths - An introduction)
Hippel, S.
Osteopathische Medizin, 2011/09
4106

Interview mit Jim Jealous über Mentoren in der Osteopathie
(Interview with Jim Jealous on mentors in osteopathy)
Jealous, J. S.
Osteopathische Medizin, 2011/09
4107

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09
4108

Medición de la emisión biofotónica antes y después de la intervención osteopática en pacientes con lumbalgia mecánica
(Measurement of biophotonic emission before and after osteopathic intervention in patients with mechanical low back pain)
Prieto Murillo, E. F.
Unpublished MSc thesis, 2011/09
Free full text
4109

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text
4110

Dynamics of indicators of quality of life in patients with chronic pain syndrome in the lumbus and lower extremities after osteopathic treatment
Yakovets, G. V., Novoseltsev, S. V.
The AAO Journal, 2011/09
Free full text
4111

From The Archives: Smith RK. Osteopathic Specialists. In: Webster GV. Concerning Osteopathy, revised ed. Carthage, NY: Floyd J. Rich; 1915, 157-164.
Smith, R. K.
The AAO Journal, 2011/09
Free full text
4112

Spondylogenic-cranial biomechanic disorders in patients with chronic cerebrovascular insufficiency in the vertebrobasilar basin and their osteopathic correction
Novoseltsev, S. V.
The AAO Journal, 2011/09
4113

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text
4114

Efecto de las técnicas de articulación y manipulación sobre los apoyos plantares en el antepié varo infantil
(Effect of articulation and manipulation techniques on plantar support in varus forefoot in children)
Ángeles Franco, M., Villarroya, A., Marcén, Y., Gómez-Gámez, A.
Osteopatía Científica, 2011/09
4115

Harold A. Blood, DO , FAAO , Memorial Lecture: 100 Years of Osteopathic Leadership
Dickey, J. L.
The AAO Journal, 2011/09
Free full text
4116

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09
4117

Osteopathic manual treatment of children with scarlet fever in the nineteenth and twentieth centuries
Liem, T., Ciranna-Raab, C.
The AAO Journal, 2011/09
Free full text
4118

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09
4119

Sprache und Kommunikation in der Osteopathie: Glossare im Internet
(Language and communication in osteopathy: glossaries on the Internet)
Risch, A. J.
Osteopathische Medizin, 2011/09
4120

Revisión sistemática del tratamiento manipulativo para el hombro doloroso
(A systematic review of manipulative therapy for the treatment of shoulder pain)
Pribicevic, M., Pollar, H., Bonell, R., de Luca, K.
Osteopatía Científica, 2011/09
4121

Criterios de calidad en investigación osteopática (III)
(Quality criteria for osteopathic research (III))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/09
4122

Research and treatment bulletin 1/2011
Blanchard, P.
International Journal of Osteopathic Medicine, 2011/09
4123

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Perrotta, A. L.
The Journal of the American Osteopathic Association, 2011/09
Free full text
4124

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text
4125

A Possible Contribution of Osteopathic Medicine in the Management of Children Affected by ADD/ADHD
Accorsi, A., Chiara, L., Di Mattia, L., Granchelli, C., Cozzolino, V., Cerritelli, F., Pizzolorusso, G., Barlafante, G.
The Journal of the American Osteopathic Association, 2011/08
4126

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08
4127

Evaluation of Osteopathic Manipulative Medicine Pretreatment for the Prevention of Acute Mountain Sickness
Li, R.C., Hwang, J., Shultz, L., Burns, J. M., Garcia-Russell, N.
The Journal of the American Osteopathic Association, 2011/08
4128

Effects of Osteopathic Cranial Manipulation on Biogenic Amine Levels, Heart Rate, and Blood Pressure in Adult Humans
Semeniken, K. R., Miller, P. A., Fuhrer, J. M., Farris, D.A., Parry, M. J., Petros, V., Corso, T.
The Journal of the American Osteopathic Association, 2011/08
4129

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08
4130

Improving Resident Research Projects by Providing a Focused Research Infrastructure and Training on Evidence-Based Practice
Weiss, L. B., Filipetto, F. A., Zipp, C. P., Gupta, A. K., Switala, C. A.
The Journal of the American Osteopathic Association, 2011/08
4131

Lymphofaszialer Release (LFR) – Faszie und Fluida in einem
(Lympho-fascia release (LFR) - fascia and fluids in one)
Chikly, B., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
4132

Lymphstau im linken Bein
(Lymphatic congestion in the left leg)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
4133

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text
4134

Osteopathische Behandlung von Neugeborenen und Kleinkindern
(Osteopathic treatment of newborns and infants)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
4135

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
4136

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text
4137

Patienteninfo: Lastenschiffer und Polizei – Lymphe und Lymphsystem
(Patient information: Cargo shippers and police - lymph and lymphatic system)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
4138

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
4139

Re: Is a postural-structural-biomechanical model, within manual therapy, viable? A JBMT debate
Franke, H.
Journal of Bodywork and Movement Therapies, 2011/07
4140

Erzielt ein Cranial base release bei TMD - Patienten einen Effekt auf die maximale aktive Mundöffnung und die subjektive Schmerzwahrnehmung?
(Will a cranial base release have an effect by TMD - Patients on the maximum active mouth opening and the subjective perception of pain?)
Beisswenger, T.
Unpublished MSc thesis, 2011/07
Free full text
4141

An investigation into the transition from student to practising osteopath
Davidson, Y. M.
Unpublished MSc thesis, 2011/07
Free full text
4142

Therapie chronischer Rückenschmerzen: Vergleich der Wirksamkeit von Weichteilosteopathie gegenüber klassischer Krankengymnastik sowie einer Kombination beider Therapiearten mit einem Herzratenvariabilitätstraining
(Therapy of chronic back pain: Comparison of the effectivity of soft part osteopathy with conventional physiotherapy and a combination of both treatments with a heart rate variability training)
Beutinger, D.
Unpublished PhD thesis, 2011/07
Free full text
4143

A review of the breastfeeding literature relevant to osteopathic practice
Cornall, D.
International Journal of Osteopathic Medicine, 2011/06
4144

Opinions on research and evidence based medicine within the UK osteopathic profession: A thematic analysis of public documents 2003–2009
Humpage, C.
International Journal of Osteopathic Medicine, 2011/06
4145

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
4146

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06
4147

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06
4148

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text
4149

Effects of comprehensive osteopathic manipulative treatment on balance in elderly patients: a pilot study
Lopez, D., King, H. H., Knebl, J. A., Kosmopoulos, V., Collins, D., Patterson, R. M.
The Journal of the American Osteopathic Association, 2011/06
Free full text
4150

Eine empirische Studie zum beruflichen Selbstverständnis von OsteopathInnen und deren Einstellung zur gesetzlichen Anerkennung der Osteopathie
(An Empirical Study on the Professional Self-Conception of Osteopaths and Their Attitude towards the Legal Acknowledgement of Osteopathy)
Riermeier, R.
Unpublished MSc thesis, 2011/06
Free full text
4151

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text
4152

Is it feasible and effective to provide osteopathy and acupuncture for patients with musculoskeletal problems in a GP setting? A service evaluation
Cheshire, A., Polley, M., Peters, D., Ridge, D.
BMC Family Practice, 2011/06
Free full text
4153

Effect of osteopathic manipulative treatment on gastrointestinal function and length of stay of preterm infants: an exploratory study
Pizzolorusso, F., Turi, P., Barlafante, G., Cerritelli, F., Renzetti, C., Cozzolino, V., D'Orazio, M., Fusilli, P., Carinci, F., D'Incecco, C.
Chiropractic & Manual Therapies, 2011/06
Free full text
4154

Osteopathic manipulative treatment in patients with low back pain
Licciardone, J. C.
Clinical Rheumatology, 2011/06
4155

Influence of craniosacral therapy on anxiety, depression and quality of life in patients with fibromyalgia
Mataran-Penarrocha, G. A., Castro-Sanchez, A. M., Garcia, G. C., Moreno-Lorenzo, C., Carreno, T. P., Zafra, M. D.
Evidence-Based Complementary and Alternative Medicine, 2011/06
Free full text
4156

Osteopathie bei Kindern und Jugendlichen mit juveniler idiopathischer Arthritis
(Osteopathy for children and adolescents with juvenile idiopathic arthritis)
Strohmayer, A.
Unpublished MSc thesis, 2011/06
Free full text
4157

Die Behandlung des Reizdarmsyndroms mit Osteopathie
(Treatment of irritable bowel syndrome with osteopathy)
Scheuchl, F. G.
Unpublished MSc thesis, 2011/06
Free full text
4158

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text
4159

Einfluss osteopathischer Behandlungen auf den Gesundheitszustand von Schichtarbeiter/innen in der baden-württembergischen Automobilindustrie, die in der Fließfertigung arbeiten
(Evaluation of the hypothesis whether osteopathic treatments have an influence on the general state of health of male and female shift workers working in flow production in the automotive industry of Baden-Wuerttemberg)
Mende-Geyer, E.
Unpublished MSc thesis, 2011/06
Free full text
4160

Überblick und Vergleich der in Österreich angebotenen Bildungsmöglichkeiten im Teilbereich Craniosacrale Osteopathie
(Overview and Comparison of the educational possibilities offered in Austria in the section craniosacralic osteopathy)
Berthold, L.
Unpublished MSc thesis, 2011/06
Free full text
4161

Wie ist der Status quo der emotionalen Kompetenz beiWSO-(Wiener Schule für Osteopathie) Abgängern in Österreich?
(What is the status quo of emotional competence among Vienna School of Osteopathy (WSO)graduates in Austria?)
Archer, B.
Unpublished MSc thesis, 2011/06
Free full text
4162

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text
4163

Klassische Osteopathie: eine Feldtheorie als Vorbild und Grundlage
(Classic osteopathy: A field theory as a model and basis)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/06
4164

The use of videos in teaching psychomotor skills: A look at a new way of teaching osteopathic manipulative treatment to a remote campus
Ferronato, M., Hruby, R. J.
The AAO Journal, 2011/06
Free full text
4165

Patients’ perceptions of post-treatment experiences in osteopathy: A qualitative study using focus groups
Bright, P., Rajendran, D., Bettles, S., Carnes, D., Mullinger, B.
European Journal of Integrative Medicine, 2011/06
Free full text
4166

Osteopathic approach to a patient with chronic fatigue syndrome
Chong, A., Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
4167

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text
4168

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
4169

Die Folgen der Armut lindern - osteopathische Behandlung in Kenia
(Alleviating the effects of poverty - osteopathic treatment in Kenya)
Abb, B.
Osteopathische Medizin, 2011/06
4170

Der viszeral assoziierte Schulterschmerz
(Viscerally Associated Shoulder Pain. Subjective Perspectives and Diagnostic Procedures ? The Osteopathic Point of View)
Fischer, U.
Unpublished MSc thesis, 2011/06
Free full text
4171

Der unmittelbare Einfluss der Osteopathie auf die Atemleistung von Mitgliedern der Feuerwehr
(The immediate effect of osteopathy on fire fighters lung function)
Hellich, W.
Unpublished MSc thesis, 2011/05
Free full text
4172

Kann die Osteopathische Behandlung das Auftreten und die Ausprägung allergischer Reaktionen bei körperlicher Belastung beeinflussen?
(Osteopathy and its effects on frequency and severity of exercise induced anaphylactic symptoms?)
Kremser, S.
Unpublished MSc thesis, 2011/05
Free full text
4173

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
4174

DOs should endorse an evidence-based national healthcare policy
Graham, J. D.
The Journal of the American Osteopathic Association, 2011/05
Free full text
4175

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text
4176

Gesundheit als Metapher. Welche Konzepte für Gesundheit haben deutschsprachige OsteopathInnen mit akademischem Hintergrund?
(Health as Metaphor - What are the concepts of health of German speaking osteopaths with an academic background?)
Risch, A. J.
Unpublished MSc thesis, 2011/05
Free full text
4177

Global Listening - Ein Test mit vielen Facetten
(Global Listening - a test with many facets)
Krall, B.
Unpublished MSc thesis, 2011/05
Free full text
4178

The Impact of an Osteopathic Medical Program on Information Technology Skills of Physicians Entering the Workforce
Bronsburg, S. E.
Unpublished PhD thesis, 2011/05
4179

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text
4180

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text
4181

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text
4182

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
4183

Efectos de las técnicas de anclaje miofascial y energía muscular en pacientes con bruxismo
(Effects of the myofascial anchorage and muscular energy techniques in patients with bruxism)
Cejo, P. E., Legal, L.
Osteopatía Científica, 2011/05
4184

Técnica de thrust para disfunción posterior unilateral del cóndilo occipital
(Thrust technique for unilateral posterior dysfunction of the occipital condyle)
Pérez Cátedra, P., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
4185

Criterios de calidad en investigación osteopática (II)
(Quality criteria in osteopathic research (II))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/05
4186

Kieferbeschwerden aus Sicht des Fasziendistorsionsmodells (FDM)
(Jaw complaints from the point of view of the fascial distortion model (FDM))
Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
4187

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4188

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4189

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4190

Psychosomatik des Kiefergelenks
(Psychosomatics of the temporomandibular joint)
Lieberman, J.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
4191

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4192

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4193

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4194

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4195

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4196

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4197

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4198

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
4199

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
4200

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
4201

Osteopathic manipulative treatment is effective on pain control associated to spinal cord injury
Arienti, C., Dacco, S., Piccolo, I., Redaelli, T.
Spinal Cord, 2011/04
Free full text
4202

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text
4203

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03
4204

An evaluation of osteopathic school programs designed to promote rural location by graduates
Whitacre, B. E., Pace, V., Hackler, J. B., Janey, M., Landgraf, C. E., Pettit, W. J.
International Journal of Osteopathic Medicine, 2011/03
4205

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
4206

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
4207

Impact of osteopathic manipulative treatment on secretory immunoglobulin a levels in a stressed population
Saggio, G., Docimo, S., Pilc, J., Norton, J., Gilliar, W.
The Journal of the American Osteopathic Association, 2011/03
Free full text
4208

Osteopathic manipulative treatment in developing countries: a call for education and research
Szkwarko, D.
The Journal of the American Osteopathic Association, 2011/03
Free full text
4209

Somatische Dysfunktion
(Somatic dysfunction)
Adler-Michaelson, P.
Osteopathische Medizin, 2011/03
4210

Interview mit Raimund Engel zur Osteopathie in Europa
(Interview with Raimund Engel about osteopathy in Europe)
Engel, R.
Osteopathische Medizin, 2011/03
4211

Osteopathische Behandlung bei Schwindel: eine Pilotstudie
(Osteopathic treatment for vertigo: A pilot study)
Fraix, M.
Osteopathische Medizin, 2011/03
4212

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03
4213

Muscle energy technique: An evidence-informed approach
Fryer, G.
International Journal of Osteopathic Medicine, 2011/03
4214

Efficacy of osteopathic manipulative treatment of female patients with migraine: results of a randomized controlled trial
Voigt, K., Liebnitzky, J., Burmeister, U., Sihvonen-Riemenschneider, H., Beck, M., Voigt, R., Bergmann, A.
The Journal of Alternative and Complementary Medicine, 2011/03
Free full text
4215

Os osteopatas em Portugal: processo de profissionalização e formação identitária
(The Osteopaths in Portugal: Professionalisation and Identity)
Henriques, A. J. d. P. B.
Unpublished MSc thesis, 2011/03
Free full text
4216

Osteopathic Manipulative Treatment of Isolated Chronic Sphenoidal Sinusitis in a Post-Sinus Surgery Patient: A Case Report
Shah, R., Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text
4217

The 2010 Northup Memorial Lecture: Low Frequency Oscillations in Human Physiology and Cranial Osteopathy
Nelson, K. E.
The AAO Journal, 2011/03
Free full text
4218

A “System” of Cranial Manipulation: An Original Contribution on Osteopathic Technique
Miller, D. S.
The AAO Journal, 2011/03
Free full text
4219

From The Archives: From: Fryette, HH. Principles of Osteopathic Technique. Carmel, CA: American Academy of Osteopathy, 1954. 61-64.
Fryette, H.H.
The AAO Journal, 2011/03
Free full text
4220

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text
4221

Internationales Symposium: Osteopathie bei Neugeborenen & Kleinkindern vom 19.-21.11.2010
(International Symposium: Osteopathy for newborns & infants from 19-21.11.2010)
Nagel, M.
Osteopathische Medizin, 2011/03
4222

Prinzipien der osteopathischen Notfalltechniken nach Robert Rousse
(Principles of osteopathic emergency techniques according to Robert Rouse)
Prediger, G.
Osteopathische Medizin, 2011/03
4223

A preliminary investigation of the effect of the osteopathic lymphatic pump technique on salivary immunoglobulin A levels in asymptomatic subjects: A single systems design pilot study
Ehrlenbach, H.
Unpublished MSc thesis, 2011/03
Free full text
4224

„Hier treffe ich Leute, die was zu sagen haben. Im Sinne von Erfahrung.“
(“Here, I meet people who have something to say. In the sense of experience“)
Vellmer, S.
Osteopathische Medizin, 2011/03
4225

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
4226

Research and treatment bulletin 2/2011
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2011/03
4227

Internationaler Konsens zur Osteopathie - die Benchmarks der WHO
(International consensus regarding osteopathy - WHO's benchmarks)
Dräger, K.
Osteopathische Medizin, 2011/03
4228

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
4229

Osteopathische Interventionen bei Erkrankungen der Prostata
(Osteopathic interventions in diseases of the prostate gland)
Marx, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
4230

Communication by degrees
Melnick, A.
The Journal of the American Osteopathic Association, 2011/02
Free full text
4231

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
4232

Management of Dupuytren contracture with ultrasound-guided lidocaine injection and needle aponeurotomy coupled with osteopathic manipulative treatment
Sampson, S., Meng, M., Schulte, A., Trainor, D., Montenegro, R., Aufiero, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
4233

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text
4234

Cranial osteopathy for children with cerebral palsy: a randomised controlled trial
Wyatt, K., Edwards, V., Franck, L., Britten, N., Creanor, S., Maddick, A., Logan, S.
Archives of Disease in Childhood, 2011/02
Free full text
4235

Osteopathy for musculoskeletal pain patients: a systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Clinical Rheumatology, 2011/02
Free full text
4236

Management of suppurative cervical lymphadenitis in a healthy 24-year-old man
Hernandez, M., Chowdhury, R., Woods, J., Cabrera, J., Hardigan, P. C.
The Journal of the American Osteopathic Association, 2011/01
Free full text
4237

Osteopathic manipulative treatment for the treatment of hospitalized premature infants with nipple feeding dysfunction
Lund, G. C., Edwards, G., Medlin, B., Keller, D., Beck, B., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
4238

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text
4239

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
4240

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text
4241

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01
4242

Osteopathic manipulation as a complementary treatment for the prevention of cardiac complications: 12-Months follow-up of intima media and blood pressure on a cohort affected by hypertension
Cerritelli, F., Carinci, F., Pizzolorusso, G., Turi, P., Renzetti, C., Pizzolorusso, F., Orlando, F., Cozzolino, V., Barlafante, G.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text
4243

What really does it have to do with osteopathy anyway? New Zealand osteopath practitioners talk about rural Māori health
Awatere, S. A.
Unpublished MSc thesis, 2011/01
Free full text
4244

HR Influence in a For-Profit Osteopathic Medical School: Staffing, Polices and Procedures
Pelletier, C.
Unpublished MSc thesis, 2011/01
4245

Desarrollo de un sistema multimedia como herramienta educativa para osteopatía estructural de la articulación sacroiliaca
(Development of a multimedia system as an educational tool for structural osteopathy of the sacroiliac joint)
Mahecha Orjuela, D. M.
Unpublished MSc thesis, 2011/01
Free full text
4246

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text
4247

Objective Measure of Effect of Osteopathic Manipulative Treatment on Balance
Gordon, A. N., Graham, V., Hurwitz, E., Fraix, M. P., Seffinger, M.
The Journal of the American Osteopathic Association, 2011/01
4248

Biomechanical assessment of kinematic measures associated with an osteopathic cervical diagnosis and treatment technique
Rutledge, B. A.
Unpublished MSc thesis, 2011/01
Free full text
4249

Osteopathic Manipulative Medicine in the Andes Mountains of Peru
Harding, S. E., Morse, J. S., Berkowitz, M. R., Tidwell, C., Bishop, K., Tidewell, B., Cruz, M. L., Morris-Mitchell, M.
The Journal of the American Osteopathic Association, 2011/01
4250

OMM and TCM: Comparisons of Manipulative Treatment
Zhang, A., Chen, S., Yen, H.R.
The Journal of the American Osteopathic Association, 2011/01
4251

Influencia de la thumb move de C7/T1 combinada con el stretching del ligamento anular del carpo sobre el área de sección transversal del nervio mediano en un caso de STC bilateral
(Influence of the thumb move at C7/T1 combined with stretching of the carpal annular ligament on a cross sectional area of the median nerve in a case of bilateral carpal tunnel syndrome)
Aguirrea, F. B., Boscá Gandíaa, J. J., Brizb, Vicente H., Pascual-Vacaa, J. O.
Osteopatía Científica, 2011/01
4252

Alteraciones en las concentraciones de amonio sérico después de la aplicación de la técnica osteopática sobre el hígado según Ralph-Faylor
(Changes in plasma ammonia levels after aplication of Ralph Failor's liver pumping technique)
Alberto de Sousa, L.
Osteopatía Científica, 2011/01
4253

The identification, assessment and management of somatisation in clients of osteopathic practitioners in New Zealand
You, H. Y.
Unpublished MSc thesis, 2011/01
Free full text
4254

A preliminary investigation into the attitudes and practices of New Zealand osteopaths in relation to the health care system: Does the future hold a greater degree of integration into the biomedical system?
Rose, L.
Unpublished MSc thesis, 2011/01
Free full text
4255

Structural or cranial osteopathy: Factors influencing practitioner preference
Norrie, J.
Unpublished MSc thesis, 2011/01
Free full text
4256

Técnica semidirecta de thrust para una disfunción somática no neutra en ERS izquierda de la tercera vértebra cervical
(Thrust technique for left ERS somatic dysfunction of the third cervical vertebra)
Guerrero, A. M., Rodríguez, R. P.
Osteopatía Científica, 2011/01
4257

Women’s attitudes to and experiences of osteopathic care during pregnancy
Kurth, A.
Unpublished MSc thesis, 2011/01
Free full text
4258

An exploration of the experience of parents in the osteopathic treatment of their infants
Gardner, K.
Unpublished MSc thesis, 2011/01
Free full text
4259

Efectos neuroFisiológicos de la manipulación vertebral
(Neurophysiological effects of spinal manipulation)
Pickar, J. G.
Osteopatía Científica, 2011/01
4260

The effect of home-exercise with and without additional osteopathic treatment for those with shoulder impingement syndrome
Darragh, T.
Unpublished MSc thesis, 2011/01
Free full text
4261

What are the factors that guide an osteopath during the process of technique choice?
Albertson, P.
Unpublished MSc thesis, 2011/01
Free full text
4262

Criterios de calidad en investigación osteopática (I)
(Quality criteria for osteopathic research (I))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/01
4263

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
4264

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text
4265

Veränderung der Wurfgenauigkeit und Wurfgeschwindigkeit bei Handballspielerinnen nach osteopathischer Intervention
(Changes in the Throwing Accuracy and Throwing Velocity of Competitive Female Handball Players after Osteopathic Intervention)
Bitter, H.
Unpublished MSc thesis, 2010/12
Free full text
4266

Wirkt sich eine viszerale Behandlung auf das parietale System aus? Eine Studie am Beispiel der arthrotischen Hüfte und der Unterbauchorgane
(Does a visceral treatment have an effect on the parietal system? A Case Study using the example of the arthritic hip and the pelvic organs)
Gosch, D.
Unpublished MSc thesis, 2010/12
Free full text
4267

The accuracy of diagnostic palpation: the comparison of soft tissue findings with random blood sugar in diabetic patients
Nelson, K. E., Mnabhi, A. K. S., Glonek, T.
Osteopathic Family Physician, 2010/12
4268

On the Role of the Glossary
Berkowitz, M. R.
The AAO Journal, 2010/12
Free full text
4269

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text
4270

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text
4271

EROP-Richtlinien: Kernkompetenzen und Praxisstandards in der osteopathischen Medizin
(EROP guidelines: Core competencies and practice standards in osteopathic medicine)
Mayer, J.
Osteopathische Medizin, 2010/12
4272

Interview mit Dr. med. Johannes Mayer zum Thema EROP-Richtlinien: Kernkompetenzen und Praxisstandards
(Interview with Dr. Johannes Mayer, M.D. on the topic EROP guidelines: Core competencies and practice standards)
Schmidt, S.
Osteopathische Medizin, 2010/12
4273

`Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text
4274

Langjährige Schilddrüsenunterfunktion und muskuläre Beschwerden: Ist Osteopathie für die betroffenen Frauen von Nutzen?
(Long-term hypothyroidism and muscle diseases: Is osteopathy of use to the afflicted women?)
Sonberg, M., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2010/12
4275

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text
4276

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12
4277

Do different practitioners attract different patients? The importance of keeping an open mind
Thornton-Smith, K., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/12
4278

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12
4279

Osteopathie und ihre Wirkung auf die „Spastizität“ bei posttraumatischer Rückenmarksläsion
(Osteopathy and its effect on “spasticity“ related to post-traumatic spinal cord lesions)
Riedl, B.
Unpublished MSc thesis, 2010/12
Free full text
4280

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
4281

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
4282

It Means Just What I Choose It to Mean--Neither More nor Less
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/12
Free full text
4283

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text
4284

Die Bekanntheit und Akzeptanz der Osteopathie bei niedergelassenen Ärzten im ländlichen und kleinstädtischen Bereich am Beispiel Wald und Weinviertel
The level of knowledge about osteopathy among medical doctors in private practice in the rural and small-town Weinviertel region
Wotruba, S.
Unpublished MSc thesis, 2010/12
Free full text
4285

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text
4286

Integrating Osteopathic Principle into Daily Practice
Hruby, R. J.
The AAO Journal, 2010/12
Free full text
4287

Kann mit Osteopathie der Stimmumfang von Sängerinnen der Stimmlage Sopran vergrößert werden?
(Can osteopathy expand the vocal compass of female singers with the voice type soprano?)
Amlinger, E.
Unpublished MSc thesis, 2010/11
Free full text
4288

Comments on “Commentary on the globalization of osteopathic medicine”
Findlay, T.
Osteopathic Family Physician, 2010/11
4289

Efficacy of a standardized osteopathic manipulative therapy protocol on pulmonary function and symptomatology in moderate persistent asthmatic children
Brady, N. S.
Annals of Allergy, Asthma and Immunology, 2010/11
4290

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text
4291

American Osteopathic Association guidelines for osteopathic manipulative treatment (OMT) for patients with low back pain
Seffinger, M. A., Buser, B. R., Licciardone, J. C., Lipton, J. A., Lynch, J. K., Patterson, M. M., Snow, R., Troutman, M. E.
The Journal of the American Osteopathic Association, 2010/11
Free full text
4292

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text
4293

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text
4294

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11
4295

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
4296

Sind Faszien in vivo und in vitro aktiv und passiv kontraktionsfähig, welche Mechanismen ermöglichen dieses Kontraktionsverhalten und welche Konsequenzen ergeben sich für die Osteopathie? Systematische Übersichtsarbeit
(Do fascia feature the capacity of active and passive contraction; which mechanisms facilitate these contractive properties; and which consequences result with regard to applied osteopathy? A systematic review)
Brand, E.M.
Unpublished D.O. thesis, 2010/10
4297

Response to “Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations“
Gimpel, J. R.
Teaching and Learning in Medicine, 2010/10
4298

New COMLEX-USA-to-USMLE conversion formula needed
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4299

Hat die osteopathische Behandlung Einfluss auf Immunparameter bei Patienten mit chronischen Rückenschmerzen? Prä-Post Pilotstudie
(Does osteopathic treatment influence immune parameters in patients with chronic low back pain? A pre-post pilot trial)
Conrady, A., Döring, R.
Unpublished D.O. thesis, 2010/10
4300

Osteopathische Behandlung von Frauen mit Harninkontinenz. Eine kontrollierte klinische Studie.
(Osteopathic treatment in women suffering from urinary incontinence. A controlled clinical trial)
Grönwald, C., Pantel, M.
Unpublished D.O. thesis, 2010/10
4301

Können osteopathische Behandlungen einen Beitrag zur Verbesserung von Miktionsbeschwerden (LUTS) bei Patienten mit benignem Prostatasyndrom (BPS) leisten? Randomisierte kontrollierte Studie.
(Do osteopathic treatments influence the lower urinary tract symptoms (LUTS) in patients with benign prostatic syndrome (BPS)? A randomized controlled trial)
Kramer, S., Schüle, G., Welzel, M.
Unpublished D.O. thesis, 2010/10
4302

Wirkt die osteopathische Behandlung bei Patienten mit Psoriasis vulgaris? Randomisierte kontrollierte Studie
(Does osteopathic treatment affect the symptoms of psoriasis vulgaris? A randomized controlled trial)
Martin, J.
Unpublished D.O. thesis, 2010/10
4303

Hat osteopathische Behandlung einen Effekt auf Schlafstörungen bei Kindern zwischen drei und zehn Jahren? Prä-Post-Pilostudie.
(Does osteopathic treatment influence sleep disturbances in children between three and ten years? Pre-post pilot trial)
Schulmeyer, A.
Unpublished D.O. thesis, 2010/10
4304

Osteopathisches Patientenprofil in Bezug auf das Gesundheitssystem in Deutschland. Umfrage 2009
(Potential existing profile of typical osteopathy users at the German Health System. A survey 2009)
Tüffers, C.
Unpublished D.O. thesis, 2010/10
4305

Systematische Übersichtsarbeit über Definition, Nomenklatur und Klassifikation der Säuglingsasymmetrie bzw. Schiefhals bei Säuglingen.
(A Systematic Review on the Definition, Nomenclature and Classification on Infantile Asymmetry, respectively, Torticolllis in Infants)
Wagner, C.
Unpublished D.O. thesis, 2010/10
4306

Management of benign paroxysmal positional vertigo with the canalith repositioning maneuver in the emergency department setting
Burmeister, D. B., Sacco, R., Rupp, V.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4307

Realigning the JAOA to sharpen our focus
Capobianco, P. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4308

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4309

Effects of rib raising on the autonomic nervous system: a pilot study using noninvasive biomarkers
Magoun Jr., H. I.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4310

OMT relieves low back pain during pregnancy
Kleman, P. G.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4311

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4312

Soul sickness: a frequently missed diagnosis
Tobe, E. H.
The Journal of the American Osteopathic Association, 2010/10
Free full text
4313

Plagiozephalie bei frühgeborenem Mädchen
(Plagiocephaly in premature baby girl)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
4314

Komplementäre Behandlung der idiopathischen Säuglingsasymmetrie
(Complementary treatment of idiopathic infant asymmetry)
Peschke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
4315

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text
4316

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/
4317

Osteopathische Erfahrungswerte mit idiopathischen Skoliosen
(Experiences regarding osteopathic treatment of idiopathic scoliosis)
Loibner-Gruendler, B.
Unpublished MSc thesis, 2010/09
Free full text
4318

Osteopathic manipulative treatment in a patient with idiopathic dysautonomia: a case presentation
Cromeens, B., Gamber, R.
Osteopathic Family Physician, 2010/09
4319

Baby-Shiatsu – eine energetische Ergänzung zur osteopathischen Behandlung
(Baby Shiatsu: An energetic supplement to osteopathic treatment)
Kalbantner-Wernicke, K., Wernicke, T.
Osteopathische Medizin, 2010/09
4320

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text
4321

Various methods of CRI palpation of body parts, their diagnostic values and interpretation of the findings
Pribadi, K. S.
The AAO Journal, 2010/09
Free full text
4322

Attitudes and Confidence Levels of Fourth Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T., Best, M., Fotopoulos, T. J., Ball, L. D., Ruston, V. J.
The AAO Journal, 2010/09
Free full text
4323

Wie viel Placebo steckt in der Osteopathie?
(How much placebo remains in osteopathy?)
Resch, K.L.
Osteopathische Medizin, 2010/09
4324

Adverse events in manual therapy: A systematic review
Carnes, D., Mars, T. S., Mullinger, B., Underwood, M.
International Journal of Osteopathic Medicine, 2010/09
4325

Effect of osteopathic treatment on the gastrointestinal system function of autistic children
Castellarin, I. B., Hucklebridge, F., Patel, V. B., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2010/09
4326

Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia: A pre-post pilot trial
Conrad, U., Scheuer, K., Hebgen, E., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
4327

Somatic dysfunctions in newborns: prevalence and interoperator correlation
Cozzolino, V., Boccuzzi, M., Evangelista, S., Germinario, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
4328

Impact of OMT on reducing length of stay in a population of pre-term infants
Cozzolino, V., La Mola, E., Ciardelli, F., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
4329

Investigating the role of vision and touch in the diagnosis of somatic dysfunction
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2010/09
4330

Development of a standardised data collection (SDC) tool to profile osteopathic practice in the United Kingdom
Fawkes, C. A., Leach, C. M. J., Mathias, S., Moore, A. P.
International Journal of Osteopathic Medicine, 2010/09
4331

The use of spinal and sacroiliac joint assessment and treatment procedures within the British osteopathic profession
Fryer, G., Johnson, J. C.
International Journal of Osteopathic Medicine, 2010/09
4332

Osteopathic manipulative treatment for chronic neck pain: A randomized placebo controlled trial on the effect on pain and disability
Mandara, A., Ceriani, A., Guzzetti, G., Gulisano, V., Fusaro, A., Bado, F.
International Journal of Osteopathic Medicine, 2010/09
4333

Osteopathy as a therapy during pregnancy: A randomised controlled trial
Nistler, G., Deutschmann, U., Lenz, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
4334

8th International conference on advances in osteopathic research – ICAOR 2010
International Journal of Osteopathic Medicine, 2010/09
4335

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Mosca, G., Orfei, S.
International Journal of Osteopathic Medicine, 2010/09
4336

Osteopathic treatment of women with primary dysmenorrhoea: A randomised controlled trial
Pinter-Haas, A., Schach-Hirte, A., Wirthwein, P., Metcalfe, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
4337

Osteopathic treatment of women with voiding dysfunction: A randomized controlled trial
Ringkamp, C., Rodriquez, B., Alberts, K., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09
4338

Osteopathic treatment of patients with shoulder pain: A randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2010/09
4339

Are student attitudes to back pain aligned with European guidelines? A survey within UK osteopathic educational institutions (OEIs) using the Attitudes to Back Pain Scale for musculoskeletal practitioners (ABS-mp)
Stokoe, J., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/09
4340

Adverse events and treatment reactions in osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2010/09
4341

Exploring European osteopathic identity: An analysis of the professional websites of European osteopathic organizations
Wagner, C., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2010/09
4342

Osteopathic management of an adult patient suffering from trigeminal neuralgia after a post-operative Arnold Chiari type 1 decompression: Case report
Zegarra-Parodi, R., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09
4343

Training in osteopathic structural techniques from a student perspective: A survey of final year students
Zegarra-Parodi, R., Renard, E.O., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09
4344

Manuelle Behandlung des Kniegelenks - veraltetes Verfahren oder alternative Option?
(Manual treatment of the knee joint – an outdated procedure or an alternative option?)
Franke, H.
Naturheilpraxis, 2010/09
Free full text
4345

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text
4346

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09
4347

Efectos de la desactivación de los puntos-gatillo de los músculos de la pantorrilla en las fascitis plantares
(The effects of calf muscle trigger-points disactivation in plantar fasciitis)
Renan Ordine, R., Alburquerque Sendín, F.
Osteopatía Científica, 2010/09
4348

Investigación en osteopatía en el ámbito internacional
(Research in osteopathy at the international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/09
4349

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text
4350

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09
4351

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07
4352

Physiotherapie et osteopathie: une prise en charge reellement holistique des sportifs.
(Physiotherapy and osteopathy: a real holistic supervision of athletes)
Larequi, Y.
Revue Medicale Suisse, 2010/08
4353

The Use of Osteopathic Manipulative Treatment in the Enhancement of Pulmonary Function in an Impoverished Urban Sector of Duran, Ecuador
Barnes, P. L., Dilzer, E. J., McAuley, D. A., Kuchera, M. L., Venditto, M. A.
The Journal of the American Osteopathic Association, 2010/08
4354

Establishment of DO-Touch.NET, an OMM Practice-Based Research Network
Degenhardt, B. F., Johnson, J. C., Hagan, C., Halma, K. D.
The Journal of the American Osteopathic Association, 2010/08
4355

Characterizing Osteopathic Manipulative Techniques Used in Treating Pneumonia During the MOPSE Study
Degenhardt, B. F., Johnson, J. C., Yang, Q., Pamperin, K. L., Noll, D. R.
The Journal of the American Osteopathic Association, 2010/08
4356

COMLEX Level 2-PE Performance Differences between Left-handed and Right-handed Candidates
Langenau, E. E., Dyer, C.
The Journal of the American Osteopathic Association, 2010/08
4357

The Effects of Cranial Osteopathy on Neuronal Damage After Juvenile Seizures
LaTorre, G. N., Copel, E., Hallas, B. H.
The Journal of the American Osteopathic Association, 2010/08
4358

A Study of 80 Healthy Subjects: Can OMM Effects and Outcomes Be Measured Objectively Using Pulmonary Function Tests?
Morine, E., Yao, S. C., Liu, T., Werley, J., Sheikh, M. W., Gilliar, W.
The Journal of the American Osteopathic Association, 2010/08
4359

The Effect of OMT on Blood Pressure in Nonhypertensive Subjects
Rezk, M., Siu, V. N., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2010/08
4360

Standardized Patients and Osteopathic Manipulative Treatment During COMLEX-USA Level 2-PE
Sandella, J. M., Pugliano, G.
The Journal of the American Osteopathic Association, 2010/08
4361

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
4362

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07
4363

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07
4364

Nasen- und Darmschleimhaut in der osteopathischen Behandlung
(Nasal and intestinal mucosa in osteopathic treatment)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
4365

Der osteopathisch ganzheitliche Ansatz zur Homöostase (Teil 2)
(The osteopathic holistic approach to homeostasis, part 2)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
4366

Encouraging OFP editorial staff to present information and articles on the use of Osteopathic manipulative care
Urse, G. N.
Osteopathic Family Physician, 2010/07
4367

Research and osteopathy: an interview with Dr Gary Fryer by Helge Franke
Franke, H.
Journal of Bodywork and Movement Therapies, 2010/07
Free full text
4368

Characteristics of pediatric patients seen in medical school-based osteopathic manipulative medicine clinics
Lund, G., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/07
Free full text
4369

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text
4370

Osteopathische Techniken bei Nasennebenhöhlenentzündung
(Osteopathic techniques in sinusitis)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
4371

CRPS und Osteopathie – Möglichkeiten und Grenzen
(CRPS and osteopathy - possibilities and limits)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
4372

Idiopathische Trigeminusneuralgie
(Idiopathic trigeminal neuralgia)
Liem, T., Kühn, D.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
4373

No effect of osteopathic treatment on trunk morphology and spine flexibility in young women with adolescent idiopathic scoliosis
Hasler, C., Schmid, C., Enggist, A., Neuhaus, C., Erb, T.
Journal of Children's Orthopaedics, 2010/06
Free full text
4374

Anterior superior iliac spine asymmetry assessment on a novel pelvic model: an investigation of accuracy and reliability
Stovall, B. A., Bae, S., Kumar, S.
Journal of Manipulative and Physiological Therapeutics, 2010/06
Free full text
4375

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text
4376

Medecine manuelle - osteopathie en France.
(Manual medicine-osteopathy in France)
Vautravers, P.
Annals of Physical and Rehabilitation Medicine, 2010/06
4377

Evidence Does Not Grow Stale with Age
Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
4378

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
4379

Low Back Pain in Rowers
Fleming, R. K., Snider, K. T.
The AAO Journal, 2010/06
Free full text
4380

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text
4381

Osteopathic Diagnosis and Treatment of Dorsalgia Caused by Disturbance of Proprioception in the Cervical Spine
Lepin, A. L., Mokhov, D. E., Novoseltsev, S. V.
The AAO Journal, 2010/06
Free full text
4382

Median Arcuate Ligament Syndrome – Literature Study and Osteopathic Considerations
Peeters, L.
The AAO Journal, 2010/06
Free full text
4383

Somatic Dysfunction Following Sigmoid Colon Resection for Diverticulitis: A Case Report
Ridgeway, V., Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
4384

Interview mit Angela Schleupen und Karl Heinz Riedl zur Osteopathie in der Frauenheilkunde
(An interview with Angela Schleupen and Karl Heinz Riedl on osteopathy in gynecology)
Schleupen, A., Riedl, K. H.
Osteopathische Medizin, 2010/06
4385

Methoden der osteopathischen Diagnostik und der Reflexdiagnostik bei Zervikalgiepatienten
(Methods of osteopathic diagnostics and reflex diagnostics in patients with cervicalgia)
Usupbékova, B. C., Mokhov, D. E., Vasilenko, A. M., Paoletti, S.
Osteopathische Medizin, 2010/06
4386

Teaching osteopathic students technique; using research to identify good teaching practice
Browning, S.
International Journal of Osteopathic Medicine, 2010/06
4387

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06
4388

Diagnostyka fizjoterapeutyczna i osteopatyczna w zawodowych zaburzeniach glosu.
(The application of physiotherapeutic and ostheopatic diagnostics in occupational voice disorders)
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Kowalska, M. S.
Medycyna Pracy, 2010/06
4389

The Influence of Rib Raising on the Lung Function of Chronic Obstructive Pulmonary Disease Patients
Friedrich, S.
Unpublished MSc thesis, 2010/06
Free full text
4390

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05
4391

L'osteopathie pour soulager certaines douleurs.
(Osteopathy for relieving certain pain)
Gnaho, S.
Revue de l'infirmiere, 2010/05
4392

International medical graduates can be the answer to osteopathic graduate medical education vacancies and international recognition of osteopathic medicine
DeLengocky, T.
Osteopathic Family Physician, 2010/05
4393

Commentary on the globalization of osteopathic medicine
Qureshi, Y., Kusienski, A. M.
Osteopathic Family Physician, 2010/05
4394

Wie gut funktioniert die Zusammenarbeit zwischen Zahnärzten und Osteopathen im Raum Steiermark?
(How efficient is the cooperation between dentists and osteopaths in Styria?)
Kaltenböck, M.
Unpublished MSc thesis, 2010/05
Free full text
4395

Changes in US healthcare: our time is now, but for what?
Cain, R. A.
The Journal of the American Osteopathic Association, 2010/05
Free full text
4396

Estudio comparativo sobre la eficacia de las técnicas de thrust y energía muscular en el músculo piriforme
(Comparative study on the efficacy of thrust and muscle energy techniques in the piriformis muscle)
Hunt, G. M., Legal, L.
Osteopatía Científica, 2010/05
4397

Fe de errores de “El efecto en el umbral del dolor en un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es infl uenciable por las expectativas del sujeto?”
(Erratum to “The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?“)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/05
4398

Repercusión de la maniobra lift de vejiga sobre el punto gatillo miofascial del músculo tibial anterior y de la apófisis espinosa de lumbar 5
(Repercussions of the urinary bladder lift manipulation on the myofascial trigger point of the tibialis anterior muscle and fifth lumbar spinous process)
Marchuk, C., Legal, L.
Osteopatía Científica, 2010/05
4399

Osteopathic diagnosis of an acetabular injury
Morthland, T., Cote, N. S., Humphrey, J., Fulk, D.
The Journal of the American Osteopathic Association, 2010/05
Free full text
4400

Modificaciones radiológicas del espacio entre el occipucio y el cuerpo del atlas tras una manipulación global (OAA) de Fryette
(Radiological changes in the atlanto-occipital space after Fryette global manipulation (OAA))
Otaño, L., Legal, L.
Osteopatía Científica, 2010/05
4401

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
4402

El desarrollo científico de la osteopatía en el ámbito internacional
(Scientific development of osteopathy at international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/05
4403

The anachronistic fight for osteopathic distinctiveness
Shore, E. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
4404

Osteopathische Behandlung von homonymen Gesichtsfeldausfällen bei Erwachsenen mit erworbener Hirnschädigung im Zuge des stationären Rehabilitationsaufenthaltes
(Osteopathy relating to homonymous hemianoptic failures with adults with acquired brain damage in the course of the stationary rehabilitation phase)
Fäßlacher, W.
Unpublished MSc thesis, 2010/05
Free full text
4405

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
4406

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
4407

Formbarkeit von Faszien und Membranen: Behandlung innerer Brücken im Kontext der Forschung
(Plasticity of Fascias and Membranes: Treatment of Inner Bridges in the Context of Research)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
4408

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
4409

Diagnose und Behandlung von Zahnschmerzen nach dem Fasziendistorsionsmodell (FDM)
(Diagnosis and treatment of dental pain according to the Fascial Distortion Model (FDM))
Stein, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
4410

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
4411

Diagnosis and management of primary pulmonary leiomyosarcoma
Arnold III., L. M., Burman, S. D., H., O-Yurvati A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4412

Adding MI principles to your communication skills: an interview with Susan Butterworth, PhD
Butterworth, S.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4413

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4414

Effect of pedal pump and thoracic pump techniques on intracranial pressure in patients with traumatic brain injuries
Cramer, D., Miulli, D. E., Valcore, J. C., Taveau, J. W., Do, N., Hutton, D. S., Sonti, G., Wogu, E., Boorman, C. F., Panchal, R. R.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4415

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4416

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4417

Musculoskeletal dysfunction and drop foot: diagnosis and management using OMM
Sucher, B. M.
The Journal of the American Osteopathic Association, 2010/04
Free full text
4418

14. Europäisches Symposium der traditionellen Osteopathie
(14th European Symposium of Traditional Osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
4419

Mikro- und makroskopische Betrachtung der Faszienfunktionen
(Microscopic and Macroscopic Reflections on the Functions of Fascias)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
4420

An introduction to clinical research in osteopathic medicine
Earley, B. E., Luce, H.
Primary Care: Clinics in Office Practice, 2010/03
Free full text
4421

DOs vs. Dos: proposed medical school creates rift between osteopathic physicians, UNT
Ortolon, K.
Texas Medicine, 2010/03
4422

Kommentar der Deutsch-Amerikanischen Akademie für Osteopathie e.V. (DAAO)
(Comment of the German-American Academy of Osteopathy (DAAO))
Adler-Michaelson, P.
Osteopathische Medizin, 2010/03
4423

Forum zum Artikel: “Wissenschaftliche Bewertung osteopathischer Verfahren”
(Forum on the article: “Scientific assessment of osteopathic procedures“. Comment of the German Society of Chiropractic and Osteopathy (DGCO))
Daichendt, D.
Osteopathische Medizin, 2010/03
4424

Holistic Osteopathic Approach Reveals Unusual Etiology for Vertigo with Co-morbid Headache: A Case Report
Berkowitz, M. R.
The AAO Journal, 2010/03
Free full text
4425

Case Study: Exhalation Somatic Dysfunction after Multiple Rib Fractures and Pneumothorax
Calman, J.
The AAO Journal, 2010/03
Free full text
4426

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text
4427

Kommentar des Verbands der Osteopathen Deutschland e.V. (VOD)
(Comment of the German Osteopathic Association (VOD))
Fuhrmann, M.
Osteopathische Medizin, 2010/03
4428

Kommentar des Deutschen Registers Osteopathische Medizin (DROM)
(Comment of the German Register of Osteopathic Medicine (DROM))
Hartwig, B.
Osteopathische Medizin, 2010/03
4429

Kommentar der Deutschen Gesellschaft für Osteopathische Medizin e.V. (DGOM)
(Comment of the German Society of Osteopathic Medicine (DGOM))
Hogrefe, C.
Osteopathische Medizin, 2010/03
4430

Leserbrief zum Artikel „Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres”
(Letter to the editor in regards to the article: 'Osteopathic treatment of developmental hip dysplasia in infants during the first year of life')
Lasovetskaya, L., Karpova, T.
Osteopathische Medizin, 2010/03
4431

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text
4432

(Comment on the letter to the editor)
Mayer, J.
Osteopathische Medizin, 2010/03
4433

Biomechanical Disorders in the Patients with Lumbar Discal Hernias and Their Osteopathic Correction
Novoseltsev, S. V., Vcherashny, D. B.
The AAO Journal, 2010/03
Free full text
4434

Kommentar des Verbands Osteopathie Schule Deutschland (VOSD)
(Comment of the Association of the Osteopathic School in Germany (VOSD))
Nagel, M.
Osteopathische Medizin, 2010/03
4435

Kommentar des Register der Traditionellen Osteopathen in Deutschland GmbH (ROD)
(Comment of the Registry of Traditional Osteopathy in Germany (ROD))
Prediger, G.
Osteopathische Medizin, 2010/03
4436

Kommentar der Akademie für Osteopathie AFO
(Comment of the Academy of Osteopathy (AFO))
Schwerla-Goeggel, B. S.
Osteopathische Medizin, 2010/03
4437

Leserbrief zum Artikel „Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres”
(Letter to the editor about the article: “Osteopathic treatment of development-conditioned hip dysplasia in infants during the first year of life“)
Spittank, H.
Osteopathische Medizin, 2010/03
4438

Wissenschaftliche Bewertung osteopathischer Verfahren: Der Vorstand der Bundesärztekammer hat in seiner Sitzung vom 28. August 2009 folgende Ausarbeitung des Wissenschaftlichen Beirats zustimmend zur Kenntnis genommen
(Scientific assessment of osteopathic procedures)
Osteopathische Medizin, 2010/03
4439

Osteopathic neuromuscular re-abilitation
Lederman, E.
International Journal of Osteopathic Medicine, 2010/03
4440

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03
4441

Can osteopathy help women with a history of hypothyroidism and musculoskeletal complaints? Outcome of a preliminary, prospective, open investigation
Sonberg, M., Mullinger, B., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/03
4442

The effect of Osteopathic Treatment on Chronic Constipation – A Pilot Study
Brugman, R., Fitzgerald, K., Fryer, G.
International Journal of Osteopathic Medicine, 2010/03
4443

AOA should support IOM report on resident work hours
Conklin, J. H.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4444

Efficacy of osteopathic manipulation as an adjunctive treatment for hospitalized patients with pneumonia: a randomized controlled trial
Noll, D. R., Degenhardt, B. F., Morley, T. F., Blais, F. X., Hortos, K. A., Hensel, K., Johnson, J. C., Pasta, D. J., Stoll, S. T.
Osteopathic Medicine and Primary Care, 2010/03
Free full text
4445

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4446

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4447

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4448

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4449

Uniform instruction using web-based, asynchronous technology in a geographically distributed clinical clerkship: analysis of osteopathic medical student participation and satisfaction
Peska, D. N., Lewis, K. O.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4450

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4451

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
4452

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text
4453

Use of osteopathic manipulative treatment to manage compensated trendelenburg gait caused by sacroiliac somatic dysfunction
Gilliss, A. C., Swanson II., R. L., Janora, D., Venkataraman, V.
The Journal of the American Osteopathic Association, 2010/02
Free full text
4454

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01
4455

Osteopathie: Die Sicht der Bundesärztekammer
(Osteopathy: The view of the German Medical Association)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
4456

Akute Irritation des Nervus cutaneus femoris lateralis
(Acute irritation of the lateral cutaneous femoral nerve)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
4457

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
4458

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01
4459

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text
4460

Osteopathic manipulative treatment of back pain and related symptoms during pregnancy: a randomized controlled trial
Licciardone, J. C., Buchanan, S., Hensel, K. L., King, H. H., Fulda, K. G., Stoll, S. T.
American Journal of Obstetrics & Gynecology, 2010/01
Free full text
4461

Dolor y estrategias terapéuticas en osteopatía (IV)
(Pain and therapeutics approaches in osteopathy (IV))
Hernández Xumet, J. E.
Osteopatía Científica, 2010/01
4462

El efecto en el umbral del dolor de un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es influenciable por las expectativas del sujeto?
(The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/01
4463

Influencia de la técnica de bombeo del globo ocular en la presión intraocular en sujetos hipertensos sometidos a medicación
(Influence of the eye pumping technique on intraocular pressure in hypertensive subjects under medication)
Sánchez Jorge, S., Palomeque del Cerro, L.
Osteopatía Científica, 2010/01
4464

Modificaciones inmediatas en la dinámica uterina tras la realización de la técnica de equilibración de la sincondrosis esfenobasilar según Upledger
(Immediate changes in the uterine dynamics after application of the balancing technique in the sphenobasilar synchondrosis according Upledger)
Vecino Rodríguez, A., Martínez Loza, E.
Osteopatía Científica, 2010/01
4465

Using Osteopathic Manipulations to Decrease the Incidence of Acute Mountain Sickness
Abo, B. N., Garcia-Russell, N., Hiserote, R. M., Wong, T., Hakopian, D. K., Burns, J. M., Ekholm, R. K.
The Journal of the American Osteopathic Association, 2010/01
4466

The Relationship Between Osteopathic Family Physicians’ Use of Manipulative Therapy and Their Perceived Empathy for Patients
Brown, J. L., Mann, D.
The Journal of the American Osteopathic Association, 2010/01
4467

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
4468

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01
4469

Osteopathic Manipulative Treatments in the Emergency Department: Osteopathic Emergency Physicians’ Perspectives
Holbrook, N. B., Fryer, G., Johnson, J. C., Holbrook, C.
The Journal of the American Osteopathic Association, 2010/01
4470

Diseño de un modelo de atención en osteopatía desde el componente de la prestación de servicios, orientado hacia el manejo de pacientes con lumbalgia de tipo mecánico, para instituciones prestadoras de servicios de salud de mediana complejidad en Colombia
(Design of an osteopathic care model from the service delivery component, oriented towards the management of patients with mechanical low back pain, for medium complexity health care institutions in Colombia)
Mejía Arango, A.
Unpublished MSc thesis, 2010/01
Free full text
4471

Anterior Cruciate Ligament Function in Osteopathic Medical Education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2010/01
4472

A Study to Investigate the Efficacy of a Novel Interactive Web-Based Virtual Clinical Scenario System (Virtual People Factory) in Medical Education
Surkunalingam, N., Walker, J., McCaskill, S., Taranto, C., Blanchard, C., Lind, D. S., Rossen, B., Lok, B.
The Journal of the American Osteopathic Association, 2010/01
4473

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
4474

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
4475

The effects of osteopathy in the cranial field on stress as measured by salivary cortisol levels
Vreede, J. E.
Unpublished MSc thesis, 2010/01
Free full text
4476

Development of a preliminary questionnaire to investigate the attitudes of NZ osteopaths regarding the use of exercise in osteopathy
Mckay-Watts, R.
Unpublished MSc thesis, 2010/01
Free full text
4477

Effect of a novel osteopathic technique on the axial length of the eye
Huang, J. H.I.
Unpublished MSc thesis, 2010/01
Free full text
4478

An exploration of the influences that shape the opinions and practices of osteopaths in relation to osteopathy in the cranial field
Braybrook, J. E.
Unpublished MSc thesis, 2010/01
Free full text
4479

Osteopathische Betrachtung der Narbenbehandlung
(Osteopathic Reflection on the Treatment of Scars)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
4480

Has osteopathy a role to play in treatment of flu?
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text
4481

Contribution of the osteopathy on the flexibility of the lumbar column and intensity of pain in young adult patients with acute low back pain
Rocha, R., Pereira, J. S.
Revista Terapia Manual, 2010
4482

Osteopathic Treatment of Patients with Chronic Non-Specific Neck Pain: Development of a Study Protocol
Schwerla, F.
Unpublished MSc thesis, 2010
Free full text
4483

Osteopathic Treatment of Female Incontinence
Hösele, K.
Unpublished MSc thesis, 2010
Free full text
4484

Effectiveness of the osteopathic treatment of women with uterine fibroids: Development of a study protocol of a randomized controlled trial
Salomon, J.
Unpublished MSc thesis, 2010
Free full text
4485

Benchmarks for Training in Osteopathy
World Health, Organization
, 2010
Free full text
4486

Development of a Study Protocol on the Osteopathic Treatment of Late Whiplash Syndrome
Kaiser, A.K.
Unpublished MSc thesis, 2010
Free full text
4487

Keeping the osteopathic medical profession parallel and distinctive
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/12
Free full text
4488

Musculoskeletal dysfunction and drop foot: diagnosis and management using osteopathic manipulative medicine
Lavelle, J. M., McKeigue, M. E.
The Journal of the American Osteopathic Association, 2009/12
Free full text
4489

Reject influence of pharmaceutical industry
McPartland, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
4490

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12
4491

Carpal tunnel syndrome: ultrasonographic imaging and pathologic mechanisms of median nerve compression
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
4492

Die Integration der Osteopathie in die öffentliche Gesundheitsversorgung in Südtirol
(The integration of osteopathy in the public health care system in South Tyrol)
Morandell, R.
Unpublished MSc thesis, 2009/12
Free full text
4493

Profile of members of the Australian Osteopathic Association: Part 2 - The patients
Orrock, P.
International Journal of Osteopathic Medicine, 2009/12
4494

Die Rolle der Osteopathie in der Korrektur von Schädeldeformierungen bei Neugeborenen und Kleinstkindern
(The role of osteopathy in correcting cranial deformations in neonates and young infants)
Amiel-Tison, C., Soyez-Papiernik, E.
Osteopathische Medizin, 2009/12
4495

Beziehung und Bindung in der osteopathischen Kinderbehandlung
(Relationship and attachment in osteopathic treatment of children)
Dräger, K., Dräger, C.
Osteopathische Medizin, 2009/12
4496

Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres
(Osteopathic treatment of developmental hip dysplasia in infants during the first year of life)
Lasovetskaya, L., Karpova, T.
Osteopathische Medizin, 2009/12
4497

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text
4498

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text
4499

Analyse critique de l’enseignement de techniques manipulatives rachidiennes basées sur les « lois de Fryette »
(Critical analysis of teaching spinal manipulation techniques based on the “Fryette laws“)
Zegarra-Parodi, R., Fabre, L.
Kinésithérapie, la Revue, 2009/12
4500

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text
4501

Empathie als Teil des Wahrnehmungsprozesses in der Osteopathie Teil II
(Empathy as part of the perception process in osteopathy, part 2)
Fiedler, I. C.
Unpublished MSc thesis, 2009/12
Free full text
4502

Der osteopathische Ansatz bei der gastroösophagealen Refluxerkrankung im Säuglingsalter
(The osteopathic approach to gastroesophageal reflux in infants)
Haindl, M.
Unpublished MSc thesis, 2009/12
Free full text
4503

The Neutral in biodynamic cranio-sacral osteopathy – an extraordinary state of consciousness
Nyul, G.
Unpublished MSc thesis, 2009/12
Free full text
4504

Osteopathy and Evidence Based Medicine. Analysis of Studies Investigating Benefits of Osteopathy as Treatment of Back Pain
Richter, A.
Unpublished MSc thesis, 2009/12
Free full text
4505

Der Einfluss der osteopathischen Behandlung auf die respiratorische Leistung bei Kindern mit Asthma bronchiale
(The influence of osteopathic treatment on the respiratory capabilities of children suffering from asthma)
Schäfer, E.M.
Unpublished MSc thesis, 2009/12
Free full text
4506

Can intraocular pressure be influenced by osteopathic treatment?
van de Kraats, A.
Unpublished MSc thesis, 2009/12
Free full text
4507

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text
4508

Effects of an osteopathic clinical based approach for the treatment of chronic non-specific low back pain in factory workers: A single cohort, pilot study
Yardley, S.
Unpublished MSc thesis, 2009/12
Free full text
4509

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text
4510

Osteopathic manipulative treatment in the management of notalgia paresthetica
Richardson, B. S., Way, B. V., Speece III., A. J.
The Journal of the American Osteopathic Association, 2009/11
Free full text
4511

Kann eine Strain Counterstrain Technik die Beschwerden beim Restless-Legs-Syndrom lindern?
(Can a Strain Counterstrain technique help to alleviate the symptoms of the Restless Legs Syndrome?)
Kroll, T.
Unpublished MSc thesis, 2009/11
Free full text
4512

Clearly distinct: outcomes of initiative to increase integration of osteopathic principles and practice at West Virginia School of Osteopathic Medicine
Steele, K. M., Baker, H. H.
The Journal of the American Osteopathic Association, 2009/11
Free full text
4513

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text
4514

Reprint of: a preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2009/11
4515

Complementary and alternative health care use in young children with physical disabilities waiting for rehabilitation services in Canada
April, K. T., Feldman, D. E., Zunzunegui, M. V., Descarreaux, M., Grilli, L.
Disability and Rehabilitation, 2009/11
4516

Chronische Prostatitis/chronisches Beckenschmerzsyndrom. Einfluss osteopathischer Behandlungen - eine randomisiert kontrollierte Studie.
(Chronic prostatitis/chronic pelvic pain syndrome. Influence of osteopathic treatment - a randomized controlled study)
Marx, S., Cimniak, U., Beckert, R., Schwerla, F., Resch, K.L.
Urologe A, 2009/11
4517

Reliabilitätsstudie über die Befunderhebung der Wirbelsäule nach der Methode der Lien Mécanique Ostéopathique
(A reliability study on spine findings according to the LMO method)
Hafen-Bardella, C.
Unpublished MSc thesis, 2009/11
Free full text
4518

Osteopathie bei akuter Hörminderung im Tieftonbereich
(Osteopathic treatment of acute hearing loss in the low-frequency range)
Raanaas, H.
Unpublished MSc thesis, 2009/11
Free full text
4519

Schulmedizin – Osteopathie Das Wissen zur Osteopathie und deren Akzeptanz bei Ärzten im Kanton Zürich
(Conventional Medicine vs. Osteopathy: Knowledge of Osteopathy and its Acceptance by Conventionally Trained Physicians in the Canton of Zurich)
Wiesend, K.
Unpublished MSc thesis, 2009/11
Free full text
4520

Maintaining distinctiveness and affordability of osteopathic medical education
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/10
Free full text
4521

3-Jahres Beobachtungsstudie osteopathischer und klinischer Parameter von Kindern mit diagnostizierter Haltungsasymmetrie
(3-year-observational-study of osteopathic and clinical parameters in children with diagnosed infantile postural asymmetry)
Bockius, D., Thomann, P.
Unpublished D.O. thesis, 2009/10
4522

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text
4523

Therapeutische Wirksamkeit der osteopathischen Behandlung bei Patienten mit funktioneller Stimmstörung
(Therapeutic effectiveness of osteopathic treatment in patients with functional dysphonia)
Braun, G., Seibl, G., Skrivanek, J.
Unpublished D.O. thesis, 2009/10
4524

Einfluss von osteopathischer und physiotherapeutischer Behandlung auf die idiopathische Säuglingsasymmetrie. Eine randomisierte kontrollierte Studie
(Evaluation of the effectiveness of osteopathic and physiotherapeutic intervention on idiopathic infantile asymmetry. A randomized controlled trial)
Brockmeyer, I., Exner-Panne, K., Peschke, K
Unpublished D.O. thesis, 2009/10
4525

Osteopathische Behandlung von Patienten mit Schulterschmerz. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of patients with shoulder pain. A randomized controlled trial)
Bube, J., Hettasch, J.
Unpublished D.O. thesis, 2009/10
4526

Untersuchung der therapeutischen Wirksamkeit osteopathischer Behandlungen bei Patienten mit chronischen Nackenschmerzen nach einem posttraumatischen Zervikalsyndrom durch ein Beschleunigungstrauma.
(Evaluation of the effectiveness of osteopathic treatments in patients with chronic neck pain after a posttraumatic cervical syndrome following a whiplash injury. A randomized controlled trial)
Engemann, K., Hofmeier, G.
Unpublished D.O. thesis, 2009/10
4527

Einfluss osteopathischer Behandlungen auf craniomandibuläre Dysfunktionen. Eine randomisierte kontrollierte Studie
(Influence of osteopathic treatments on Craniomandibular Dysfunction. A randomized controlled trial)
Gerber, B., Kästner, K., Schrammek, T.
Unpublished D.O. thesis, 2009/10
4528

Biomedical research competencies for osteopathic medical students
Cruser, D. A., Dubin, B., Brown, S. K., Bakken, L. L., Licciardone, J. C., Podawiltz, A. L., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text
4529

Hat eine entstauende osteopathische Leberbehandlung einen messbaren Einfluss auf den Durchfluss der Lebervenen?
(Do osteopathic liver-decongestion techniques influence the flow rate of the hepathic veins measurably?)
Haermeyer, C., Pott, S.
Unpublished D.O. thesis, 2009/10
4530

The immediate effect of individual manipulation techniques on pulmonary function measures in persons with chronic obstructive pulmonary disease
Noll, D. R., Johnson, J. C., Baer, R. W., Snider, E. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text
4531

Auswirkung von osteopathischen Behandlungen auf das Metabolische Syndrom
(Effectiveness of osteopathic treatment on the Metabolic Syndrome)
Kaske, R., Wittchow, R.
Unpublished D.O. thesis, 2009/10
4532

Haben osteopathische Behandlungen einen positiven Einfluss auf das Symptombild von Frauen, die an Endometriose erkrankt sind? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments influence the symptom-pattern in women suffering from endometriosis positively?)
Koop Dick, S.
Unpublished D.O. thesis, 2009/10
4533

(Does osteopathic treatment influence thoracolumbar junction back pain positively?)
Lützelberger, N.
Unpublished D.O. thesis, 2009/10
4534

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text
4535

Osteopathische Behandlung von Frauen mit Blasenentleerungsstörungen (BES). Eine randomisierte kontrollierte Studie
(Osteopathic treatment of women with voiding dysfunction. A randomized controlled trial)
Ringkamp, C., Rodriquez, B.
Unpublished D.O. thesis, 2009/10
4536

Osteopathie bei saisonal bedingter allergischer Rhinokonjunktivitis. Eine randomisierte kontrollierte Studie
Osteopathic treatment on Seasonal Allergic Rhinoconjuntivitis. A randomized controlled trial
Sachse-Sterlemann, K., Wernicke, K.
Unpublished D.O. thesis, 2009/10
4537

The impact of visceral osteopathic treatment on the meconium evacuation in very low birth weight infants
Haiden, N.
Unpublished MSc thesis, 2009/10
Free full text
4538

Effekte osteopathischer Behandlung auf Adipositias im Jugenalter. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment on adolescent obesity. A randomized controlled trial)
Schöndorfer, S., Wentzke, S.
Unpublished D.O. thesis, 2009/10
4539

Der Einfluss des Kontaktes zwischen Therapeut und Patient in der manuellen Therapie und Konsequenzen für die Osteopathie
(The impact of therapist-patient contact in manual therapy and its consequences on osteopathy)
Stöcker, R.
Unpublished D.O. thesis, 2009/10
4540

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4541

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4542

Erfahrungsbericht aus dem Basketball–Trainingslager
(Report on the Experiences Gained During the Basketball Training Camp of the Men's National Team)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4543

Akuter Bandscheibenvorfall
(Acute spinal disk herniation)
Klein, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4544

Neue Sportosteopathieausbildung an der OSD
(New sports osteopathy education at OSD)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4545

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4546

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4547

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
4548

Migräne bei Kindern und Jugendlichen. Eine randomisierte kontrollierte Studie
(Migraine in children and adolescents. A randomized controll trial)
Aarts, U., Sterenberg, M., Wijnen, A.
Unpublished D.O. thesis, 2009/10
4549

Eficacia de la técnica osteopática de liberación del hueso lagrimal en la obstrucción congénita del conducto nasolagrimal
(Efficacy of the osteopathic technique of lacrimalis bone release in children with congenital nasolacrimal duct obstruction)
Navarro, J. P., Capo i Giner, J. V.
Osteopatia Cientifica, 2009/09-12
Free full text
4550

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text
4551

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
4552

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text
4553

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09
4554

Osteopathie nach HWS-Schleudertrauma
(Osteopathy after whiplash injury)
Tempelhof, S.
Osteopathische Medizin, 2009/09
4555

Measurement of Cranial Palpation Pressures used by Professional Osteopaths
Zegarra-Parodi, R., De Chauvigny De Blot, P., Rickards, L., Naili, S., Renard, E.
European Journal of Pain, 2009/09
Free full text
4556

Application of Osteopathy in the Cranial Field to Successfully Treat Vertigo: A Case Series
Berkowitz, M. R.
The AAO Journal, 2009/09
Free full text
4557

A case report of Osteopathic Manipulative Treatment in a 14 year-old girl with McCune-Albright Syndrome
Colonvega, M., Hensel, K., Minotti, D. II., Williams, S.
The AAO Journal, 2009/09
Free full text
4558

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
4559

Uncontrolled Asthma: Osteopathic Manipulative Treatment Applied in a Rural Setting
Sanchez, J. Jr.
The AAO Journal, 2009/09
Free full text
4560

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09
4561

Survey, systematisation and comparison of the Master of Science in Osteopathy training programmes by means of three schools
Höltl, A.
Unpublished MSc thesis, 2009/09
Free full text
4562

Ist die Ernährung Bestandteil der osteopathischen Untersuchung und Behandlung von selbständigen Osteopathen?
(Do self-employed osteopaths take nutrition into account when conducting diagnosis and treatment?)
Meuser-Scheliga, M.
Unpublished MSc thesis, 2009/09
Free full text
4563

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09
4564

Swedenborg's influence on Sutherland's ‘Primary Respiratory Mechanism’ model in cranial osteopathy
Jordan, T.
International Journal of Osteopathic Medicine, 2009/09
4565

Principios de la osteopatía en la investigación
(Osteopathic principles in research)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/09
4566

Influencias de la relación maxilomandibular en el tratamiento postural mediante inhibición muscular
(Influence of maxillomandibular relationship in postural treatment involving muscle inhibition)
Rodríguez Blanco, C., Torres-Lagares, D., Munuera-Martínez, P. V., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
4567

Fibromyalgia Treatment Trial With Gabapentin and Osteopathic Manipulative Medicine
Bernard, N., Marske, C. S., Palacios, A., Preiss, B., Bhattacharya, S., Brown, M., Wheeler, C., Fatunde, T.
Journal of Osteopathic Medicine, 2009/08
4568

Impact of osteopathic manipulative treatment on cost of care for patients with migraine headache: a retrospective review of patient records
Schabert, E., Crow, W. T.
The Journal of the American Osteopathic Association, 2009/08
Free full text
4569

Prevention in Osteopathic Undergraduate Medical Education: A Survey of the Core Competencies in Disease Prevention and Health Promotion
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2009/08
4570

The Osteopathic Physician and End-of-Life Care
Hernandez, M. B., Ledbetter, S. L., Trevil, R., Perez, A. M., White, C.
The Journal of the American Osteopathic Association, 2009/08
4571

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text
4572

Osteopathic Physicians and HIV/STI Prevention: Are HIV Testing and Sexual History–Taking Part of Routine Patient Care?
Gongidi, P., Bowen, G. S., Fernandez, I. M.
The Journal of the American Osteopathic Association, 2009/08
4573

The use of osteopathic manipulative treatment as adjuvant therapy in patients with peripheral arterial disease
Lombardini, R., Marchesi, S., Collebrusco, L., Vaudo, G., Pasqualini, L., Ciuffetti, G., Brozzetti, M., Lupattelli, G., Mannarino, E.
Manual Therapy, 2009/08
Free full text
4574

Teaching Psychiatry in Osteopathic Medical Schools: A Survey of Current Curriculum and a Suggested Primary Care Approach
Lowe, M., Murphy, M.
The Journal of the American Osteopathic Association, 2009/08
4575

Creation of a Database Template for Performing a Retrospective Chart Review of an OMM Hospital Consultation Service
Snider, K. T., Snider, E. J., Bukowski, A. M., Johnson, J. C., DeGooyer, B. R.
The Journal of the American Osteopathic Association, 2009/08
4576

Retrospective Chart Review of the OMM Hospital Consultation Service at NRMC - Preliminary Results
Snider, K. T., Snider, E. J., DeGooyer, B. R., Johnson, J. C., Bukowski, A. M.
The Journal of the American Osteopathic Association, 2009/08
4577

MRI Assessment of Responses to Manipulative Treatment of Individuals With Low Back Pain
Walkowski, S. A., Eland, D. C., Clark, B. C., Conatser Jr., R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2009/08
4578

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08
4579

Amelioration of Oxidative Stress and Motor Deficits With Osteopathic Manipulative Treatment in a Mouse Model for Human Parkinson Disease
Zakhary, S., Jose, R., Dileo, J., Ayubcha, D., Hallas, B. H., Torres, G., Leheste, J.
The Journal of the American Osteopathic Association, 2009/08
4580

The DO difference: an analysis of causal relationships affecting the degree-change debate
Bates, B. R., Mazer, J. P., Ledbetter, A. M., Norander, S.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4581

Stop smoking, save money, get free OMM
Byrnes Jr., T. R.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4582

Cranial palpation pressures used by osteopathy students
Kary, D.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4583

Letter to the Editor (2) Regarding “Brachial Plexus Injuries in Neonates”
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4584

Survey results: OMT and CAM
Ramos, R. L., Sharma, S., Lipoff, D. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4585

Osteopathy in the cranial field provides an important contribution to the practice of medicine as a clinical application of osteopathic principles
Rosen, M. E.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4586

Brachial plexus injuries in neonates
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4587

The road to becoming an osteopathic physician is long for a good reason
Zubcevik, N.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4588

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text
4589

Towards evidence based medicine for paediatricians. Is cranio-sacral therapy useful in the management of crying babies?
Bradley, E., Finlay, F.
Archives of Disease in Childhood, 2009/07
4590

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text
4591

An investigation into the regulation of intra-cranial pressure and its influence upon the surrounding cranial bones
Gard, G.
Journal of Bodywork and Movement Therapies, 2009/07
4592

Exploring European osteopathic identity: An analysis of professional websites of European osteopathic organizations
Wagner, C.
Unpublished MSc thesis, 2009/07
Free full text
4593

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
4594

Hand anlegen beim akuten Schulterschmerz?
(Lay a hand on acute shoulder pain?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
4595

Akute Krankheitsbilder – Möglichkeiten und Grenzen der klinischen Osteopathie heute
(Acute Clinical Pictures – Chances and Limits of Today's Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
4596

Sinusitis
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
4597

Akute Halswirbelsäulenerkrankungen – Grenzbereiche
(Frontiers – Acute Diseases of the Cervical Spine)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
4598

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text
4599

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Reeves, R. R., Burke, R. S.
The Journal of the American Osteopathic Association, 2009/06
Free full text
4600

Intent to “teach“ and pay to play in osteopathic medical education
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/06
Free full text
4601

Comments on cranio-sacral method and efficacy
Blacklaw-Jones, R. D.
International Journal of Osteopathic Medicine, 2009/06
4602

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text
4603

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text
4604

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06
4605

The effects of high-velocity low-amplitude thrust manipulation and mobilisation techniques on pressure pain threshold in the lumbar spine
Thomson, O. P., Haig, L., Mansfield, H.
International Journal of Osteopathic Medicine, 2009/06
4606

Einfluss von osteopathischen Behandlungen auf die Leistungsfähigkeit von Hobbyläufern: Masterthesis zur Erlangung des Masters of Science Osteopathie an der Donauuniversität Krems 2007
(Effect of osteopathic treatment on the athletic performance of hobby runners)
Haberl, F. J.
Osteopathische Medizin, 2009/06
4607

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text
4608

AM Last Page: Osteopathic medicine in the U.S.A
Cummings, M., Rohrer, J.
Academic Medicine, 2009/06
Free full text
4609

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text
4610

Clinical practice characteristics of osteopathic and allopathic primary care physicians at academic health centers: results from the National Ambulatory Medical Care Survey
Licciardone, J. C., Clearfield, M. B., Guillory, V. J.
Academic Medicine, 2009/06
Free full text
4611

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text
4612

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
4613

Schwindel in der osteopathischen Praxis
(Dizziness in osteopathy practice)
Thomas, D.
Osteopathische Medizin, 2009/06
4614

Ein Wintermärchen: 13. Europäisches Symposium der Traditionellen Osteopathie
(A winter fairy tale: The 13th European Symposium on Traditional Osteopathy)
Vellmer, S.
Osteopathische Medizin, 2009/06
4615

The separate osteopathic medical education pathway: isn't it time we got our acts together? Counterpoint
Cohen, J. J.
Academic Medicine, 2009/06
Free full text
4616

Osteopathic manual medicine for vertigo: review of literature, case report, and future research
Fraix, M.
The AAO Journal, 2009/06
Free full text
4617

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text
4618

OMT as an adjunct therapy for post-traumatic headache in U.S. soldiers: A case series
Kozminski, M., Kozminski, T.
The AAO Journal, 2009/06
Free full text
4619

Osteopathic Manipulative Management in Sudden Infant Death Syndrome
MacDonald, R. C.
The AAO Journal, 2009/06
Free full text
4620

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text
4621

Case Study: An Osteopathic Approach to Management of a Patient with Charcot-Marie Tooth Syndrome Type II
Thoreson, M.
The AAO Journal, 2009/06
Free full text
4622

O efeito imediato da manipulação talocrural na estabilidade unipodal de tornozelo
(Immediate effects of talocrural manipulation on ankle monopodalic stability)
Xavier, M., Pires, V. A., Albertini, R. A., Arrieiro, A. N., Manuard, P., Almeida, L. C., de, Souza R. A.
Revista terapia manual, 2009/05-06
4623

Contraindications in Osteopathy
Gatterbauer, A.
Unpublished MSc thesis, 2009/05
Free full text
4624

Treatment approaches in osteopathy for the therapy of migraine
Michal, I.
Unpublished MSc thesis, 2009/05
Free full text
4625

Umstellung von Physiotherapie auf Osteopathie – ein problembelasteter Prozess für Therapeuten in Deutschland?
(Re-orientation of a Practice from Physiotherapy to Osteopathy - A problematic process for therapists in Germany?)
Wieligmann, J.
Unpublished MSc thesis, 2009/05
Free full text
4626

The three leaves of Glénard- An examination of a functional aspect
Wolke, N.
Unpublished MSc thesis, 2009/05
Free full text
4627

Osteopathic manipulative medicine in pregnancy: Acute physiological and biomechanical effects
Hensel, K. L.
Unpublished PhD thesis, 2009/05
4628

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text
4629

Osteopathic manipulative treatment and carpal tunnel syndrome: Analysis of pathogenesis, mechanisms of treatment and applicability to specific and general populations
Walz, B. D.
Unpublished MSc thesis, 2009/05
4630

Efectos inmediatos del estiramiento de los músculos isquiosurales en el sistema estomatognático en la cervicalgia mecánica
(The immediate effects of hamstring muscle stretching on the stomatognathic system in mechanical neck pain)
Bretischwerdt, C., Rivas, L., Palomeque, L., Alburquerque, F.
Osteopatía Científica, 2009/05
4631

Impacto de las técnicas manuales usadas en osteopatía sobre los propioceptores musculares: revisión de la literatura científica
(Impact of manual osteopathic techniques on muscle proprioceptors: a literature review)
González, I.
Osteopatía Científica, 2009/05
4632

Estenosis foraminal con radiculopatía debida a hernia de disco cervical en un varón de 33 años tratado con manipulación de flexión-distracción de Cox de descompresión
(Foraminal stenosis with radiculopathy from a cervical disc herniation in a 33-year-old man treated with flexion distraction decompression manipulation)
Gudavalli, S., Kruse, R. A.
Osteopatía Científica, 2009/05
4633

Dolor y estrategias terapéuticas en osteopatía (III)
(Pain and therapeutic approaches in osteopathy (III))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/05
4634

Técnica semidirecta de thrust con kick para lesión de ilíaco anterior izquierdo
(Semidirect thrust kick technique in left anterior iliac dysfunction)
Mancha, J. A. D., Martín, C. O.
Osteopatía Científica, 2009/05
4635

Osteopatía basada en la evidencia
(Evidence-based osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/05
4636

Repercusiones sintomáticas de la técnica dog en extensión bilateral sobre D5/D6 en pacientes dispépticos
(Symptomatic impact of the bilateral extension dog technique on T5-T6 in dyspeptic patients)
Sánchez Jiménez, E., Díaz, J. R.
Osteopatía Científica, 2009/05
4637

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text
4638

Estimating cost of care for patients with acute low back pain: a retrospective review of patient records
Crow, W. T., Willis, D. R.
The Journal of the American Osteopathic Association, 2009/04
Free full text
4639

Modificaciones en la presión intraocular y la presión arterial en pacientes con diabetes mellitus tipo 1 tras la manipulación global occipucio-atlas-axis según Fryette. Ensayo clínico aleatorizado
(Modifications in intraocular and blood pressure in type I diabetics after Fryette's occiput-atlas-axis manipulation. A randomized clinical trial)
Díaz Cerrato, I., Martínez Loza, E., Martín-Ampudia Ugena, M. I.
Osteopatía Científica, 2009/04
4640

Spinal and sacroiliac assessment and treatment techniques used by osteopathic physicians in the United States
Fryer, G., Morse, C. M., Johnson, J. C.
Osteopathic Medicine and Primary Care, 2009/04
Free full text
4641

Dolor y estrategias terapéuticas en osteopatía (II)
(Pain and therapeutic approaches in osteopathy (II))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/04
4642

Validez del test de deslizamiento posteroanterior cervical medio respecto a análisis radiológico dinámico
(Validity of the postero-anterior middle cervical spine gliding test with respect to dynamic radiological analysis)
Rey Eiriz, G., Alburquerque Sendín, F., Barrera Mellado, I., Martín Vallejo, F. J.
Osteopatía Científica, 2009/04
4643

La investigación, el desarrollo y la innovación en osteopatía
(Research, development and innovation in osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/04
4644

Osteopatía en un trastorno grave de la deglución
(Osteopathic medicine in severe swallowing dysfunction)
Velasco Roldán, O., Pascual-Vaca, J. O., Solana Díaz, M. T., Outón Ruíz, L., Sebastián Rausell, J. M.
Osteopatía Científica, 2009/04
4645

Etudiant osteopathe en geriatrie
(Osteopathy student in geriatrics. Interview by Agnes Maillard)
Forget, S.
Soins. Gerontologie, 2009/03-04
4646

An investigation into the effects of manual technique targeted towards psoas major muscle on lumbar range of motion
Gabin, M.
Unpublished MSc thesis, 2009/03
Free full text
4647

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4648

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4649

Don't neglect the “art“ of medicine
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4650

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4651

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques
Noll, D. R.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4652

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03
4653

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4654

Does osteopathic manipulative treatment (OMT) improves outcomes in patients who develop postoperative ileus: A retrospective chart review
Crow, W. T., Gorodinsky, L.
International Journal of Osteopathic Medicine, 2009/03
4655

Introducing the new masterclass section
Moran, R.
International Journal of Osteopathic Medicine, 2009/03
4656

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
4657

Profile of members of the Australian Osteopathic Association: Part 1 - The practitioners
Orrock, P.
International Journal of Osteopathic Medicine, 2009/03
4658

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03
4659

A Case History of Recent Problem Breathing and Special OMT for the Heart
Chapello, I. A.
The AAO Journal, 2009/03
Free full text
4660

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text
4661

Comparison of osteopathy with manual therapy (according to the CRAFTA® concept) for the treatment of patients with craniomandibular dysfunctions (CMD)
Hörster, A.
Unpublished MSc thesis, 2009/03
Free full text
4662

Treatment of the monosymptomatic Nocturnal enuresis
Scheible, B.
Unpublished MSc thesis, 2009/03
Free full text
4663

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
Manual Therapy, 2009/03
Free full text
4664

Anamnesegesteuerte Palpation
(Anamnesis-guided palpation)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
4665

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text
4666

New horizons for research and education in osteopathic manipulative medicine
Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2009/02
Free full text
4667

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
4668

Professional satisfaction among new osteopathic family physicians: a survey-based investigation of residency-trained graduates
Simpson, C., Cutright, M., Heh, V., Simpson, M. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
4669

Cranial palpation pressures used by osteopathy students: effects of standardized protocol training
Zegarra-Parodi, R., de Chauvigny de Blot, P., Rickards, L. D., Renard, E.O.
The Journal of the American Osteopathic Association, 2009/02
Free full text
4670

Osteopathic Medicine and Primary Care looks forward to 2009
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/02
Free full text
4671

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02
4672

Spracherwerb und osteopathische Gedanken zur Dyslalie
(Language acquisition and osteopathic thought in regards to dyslalia)
Riedel, M.
Osteopathische Medizin, 2009/02
4673

Abenteuer Osteopathie: Die Arbeit des Vereins Internationale Osteopathie e.V. (INO)
(The adventure of osteopathy: The work of the INO (Verein Internationale Osteopathie e.V.))
Ries, M., Bauer, C.
Osteopathische Medizin, 2009/02
4674

Fifth International Symposium on Advances in Osteopathic Research
Schwerla, F.
Osteopathische Medizin, 2009/02
4675

Osteopathy and pregnancy
Hyde, D.
The Practising Midwife, 2009/02
4676

Hat eine osteopathische Behandlung Einfluss auf den emotionalen Gefühlszustand?
(Does an osteopathic treatment have any influence on emotions?)
Dettling, C.
Unpublished MSc thesis, 2009/02
Free full text
4677

Einfluss der Osteopathie auf Uroflowmetrie, Miktionsbeschwerden und Lebensqualität bei Männern mit einer symptomatischen benignen Prostatahyperplasie
(Influence of Osteopathy on Uroflowmetry, Lower Urinary Tract Symptoms and Quality of Life in Men with Symptomatic Benign Prostatic Hyperplasia)
Gadringer, K.H.
Unpublished MSc thesis, 2009/02
Free full text
4678

Criteria to Determine Intervals of Treatment
Halasz, C.
Unpublished MSc thesis, 2009/02
Free full text
4679

Dissecting: how does it change the professional practice and the perspective of an osteopath?
Kober, E.
Unpublished MSc thesis, 2009/02
Free full text
4680

Osteopathy - the way from therapy to prevention
May, M.
Unpublished MSc thesis, 2009/02
Free full text
4681

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text
4682

Is the osteopathic treatment to be seen as an alternative method for treating and successfully supporting opiate addicts during withdrawal and detoxication?
Neuhold, G.
Unpublished MSc thesis, 2009/02
Free full text
4683

Is there an Unanimous Opinion on William Garner Sutherland’s Biodynamic Model among Osteopaths in Certain Parts of Germany?
Gehrmann, W.
Unpublished MSc thesis, 2009/02
Free full text
4684

The effect of osteopathic manipulative techniques on diaphragm movement and respiratory function in asymptomatic subjects
Hosking, S.
Unpublished MSc thesis, 2009/01
Free full text
4685

What is potency? Exploring practitioners’ experiences of the phenomenon of potency in osteopathy in the cranial field
Harrison, H.
Unpublished MSc thesis, 2009/01
Free full text
4686

An investigation of patient experiences of treatment in the cranial field of osteopathy
Greene, D.
Unpublished MSc thesis, 2009/01
Free full text
4687

Work related musculoskeletal disorders among osteopaths practicing in New Zealand: A national survey
Fitchew, G. J.
Unpublished MSc thesis, 2009/01
Free full text
4688

Preliminary prediction models for autonomic nervous system response to a cranial osteopathic technique
Collard, K.
Unpublished MSc thesis, 2009/01
Free full text
4689

Attitudes and beliefs of New Zealand osteopaths towards chronic pain
Carrington, A. L.
Unpublished MSc thesis, 2009/01
Free full text
4690

An investigation of the experience of osteopathically treating babies with breastfeeding problems
Carey, L.
Unpublished MSc thesis, 2009/01
Free full text
4691

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text
4692

An Analysis of the Use of Web-Based Materials by Medical Students and its Relationship to Learning Style
Halbert, C., Fresa-Dillon, K., Kriebel, R., Coughlin, P., Cuzzolino, R.
The Journal of the American Osteopathic Association, 2009/01
4693

A for-profit medical school
Mychaskiw, G., 2nd, Wiltshire
Academic Medicine, 2009/01
Free full text
4694

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01
4695

Osteopathic Manipulative Medicine Efficacy on Pulmonary Function as Measured by Spirometry
Liu, T., Werley, J., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2009/01
4696

Salivary IgA Fluctuations in Response to Stress and Osteopathic Manipulative Treatment
Norton, J., Pilc, J., Saggio, G., Gilliar, W.
The Journal of the American Osteopathic Association, 2009/01
4697

Ist die Osteopathie eine sinnvolle Maßnahme in Kombination mit Hippotherapie bei einem CP-Kind?
Is Osteopathy combined with Hippotherapy a Sensible Therapeutic Measure for the Treatment of Children with Cerebral Palsy?
Günter, P.
Unpublished MSc thesis, 2009/01
Free full text
4698

Osteopathen/innen und ihre eigene Gesundheit
(Osteopaths and their own health)
Hlucil, C.
Unpublished MSc thesis, 2009/01
4699

The Use of Osteopathic Manipulation in a Clinic and Home Setting to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
Unpublished PhD thesis, 2009/01
4700

Wie lassen sich osteopathische Techniken für die Behandlung von Kindern adaptieren? – Die Herangehensweise des Osteopathischen Zentrums für Kinder in Wien
(How Can Osteopathic Techniques Be Adapted for the Treatment of Children?)
Burian–Lang, E., Mückler, A., Urbanek, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
4701

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
4702

New Zealand osteopaths’ attitudes to ‘Evidence-based practice’ – development of a questionnaire and preliminary results
Wittwer Blaser, P.
Unpublished MSc thesis, 2009/01
Free full text
4703

An investigation of why osteopaths choose to leave the profession
Kleinbaum, A.
Unpublished MSc thesis, 2009/01
Free full text
4704

Healing Hands: Using Osteopathic Manipulative Treatment to Address Visceral Structures through Somatovisceral Reflexes: A Case Study in Gastroesophageal Reflux Disease
Branyon, B.
The AAO Journal, 2008/12
Free full text
4705

Contemplations on the Art of OMT After Thirty Years of Practice: 2008 Northup Lecture
Steele, K. M.
The AAO Journal, 2008/12
Free full text
4706

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text
4707

Test-dependent osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system: A pre-post pilot trial
Zorgman, M., Sauerburger, S., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12
4708

Exploring the use of exercise therapy in UK osteopathic practice
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2008/12
4709

Service delivery characteristics of UK osteopaths – a cross sectional survey
Vogel, S., Herrick, R.
International Journal of Osteopathic Medicine, 2008/12
4710

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K.L.
International Journal of Osteopathic Medicine, 2008/12
4711

A randomised controlled trial on the effectiveness of osteopathic manipulative treatment of chronic low back pain
Mandara, A., Fusaro, A., Musicco, M., Bado, F.
International Journal of Osteopathic Medicine, 2008/12
4712

The assessment of clinical practice in osteopathic education: Is there a need to define a gold standard?
London, S.
International Journal of Osteopathic Medicine, 2008/12
4713

Attitudes towards research in Australian and New Zealand osteopaths
Gosling, C., Moran, R., Vogel, S.
International Journal of Osteopathic Medicine, 2008/12
4714

How do patients feel post-treatment? pilot study at a UK osteopathic teaching clinic of self-reported adverse events
Froud, R., Rajendran, D., Fossum, C., Collins, P., Mullinger, B.
International Journal of Osteopathic Medicine, 2008/12
4715

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12
4716

Multisensory integration in an osteopathic clinical examination setting
Esteves, J. E., Geake, J., Spence, C.
International Journal of Osteopathic Medicine, 2008/12
4717

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text
4718

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12
4719

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12
4720

Assessing clinical competence in osteopathic education: Analysis of outcomes of different assessment strategies at the British School of Osteopathy
Abbey, H.
International Journal of Osteopathic Medicine, 2008/12
4721

Mathematical analysis of applied loads on skeletal muscles during manual therapy
Chaudhry, H., Bukiet, B., Findley, T.
The Journal of the American Osteopathic Association, 2008/12
Free full text
4722

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text
4723

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text
4724

Cambios en la presión arterial y frecuencia cardíaca después de una presión sobre la válvula aórtica en sujetos con hipertensión arterial esencial
(Changes in arterial pressure and cardiac frequency after pressure on the aortic valve in patients with essential hypertension)
Benito, M. M., Marín, R. C.
Osteopatía Científica, 2008/12
4725

Eficacia de una técnica de thrust para la disfunción glenohumeral en superioridad
(Efficacy of a thrust technique for upward glenohumeral dysfunction)
García Vila, S. F., Sánchez, C. C.
Osteopatía Científica, 2008/12
4726

Dolor y estrategias terapéuticas en osteopatía (I)
(Pain and therapeutic approaches in osteopathy (I))
Hernández Xumet, J. E.
Osteopatía Científica, 2008/12
4727

Eficacia del tratamiento osteopático en la rinosinusitis crónica del adulto
(Efficacy of osteopathic treatment in adult chronic rhinosinusitis)
Méndez Sánchez, R.
Osteopatía Científica, 2008/12
4728

La osteopatía como método científico
(Osteopathy as a scientific method)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2008/12
4729

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text
4730

Eine Annäherung an die Craniosacral-Arbeit in der Kinderkrankenpflege.
(Familiarity with craniosacral nursing in pediatric nursing)
Potzinger, S.
Kinderkrankenschwester, 2008/12
4731

Spinal and sacroiliac joint assessment and treatment within the American osteopathic profession
Fryer, G., Morse, C., Johnson, J. C.
International Journal of Osteopathic Medicine, 2008/12
4732

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12
4733

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12
4734

The hands of the osteopaths. Thinking fingers. Their special training
Hansak, S.
Unpublished MSc thesis, 2008/11
Free full text
4735

How often are thrust techniques used in practice
Pingitzer, T.
Unpublished MSc thesis, 2008/11
Free full text
4736

Neurobiologische Aspekte eines Knackgeräusches im Rahmen einer HVLA Technik
(Neurobiological aspects of a cracking noise within the framework of an HVLA technique)
Beck, M.
Osteopathische Medizin, 2008/11
4737

Osteopathie zur Optimierung des Golfschwunges
(Osteopathy for the optimization of the golf swing)
Marcucci, S.
Osteopathische Medizin, 2008/11
4738

Kalzifikation der Supraspinatussehne- ein osteopathischer Ansatz?
(Calcification of the Supraspinatus muscle - an osteopathic approach?)
Schwarz, H.
Unpublished MSc thesis, 2008/11
Free full text
4739

Mobility and other parameters of the musculoskeletal system before and after an osteopathic treatment of the eye and its directly connected structures with patients having myopia, hyperopia and/or astigmatism
Pesendorfer, M.
Unpublished MSc thesis, 2008/11
Free full text
4740

Osteopathie in der Pädiatrie, Teil 4: Sakrum und Os sphenoidale
(Osteopathy in Pediatrics Part 4: Sacrum and Os Sphenoidale)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
4741

Der Einfluss osteopathischer Behandlungsmethoden bei craniomandibulären Dysfuntionen
(The influence of osteopathic treatment on temporomandibular disorders)
Radosai, F.
Unpublished MSc thesis, 2008/11
Free full text
4742

Can osteopathic treatments improve the overall picture of the patient with a common migraine?
Spannbauer, M.
Unpublished MSc thesis, 2008/11
Free full text
4743

Die Wirksamkeit einer osteopathischen Intervention bei Patienten mit einem einseitigen Tinnitus-aurium
(The effectiveness of osteopathic intervention at patients with a single-sided tinnitus aurium)
Twigt, P.
Unpublished MSc thesis, 2008/11
Free full text
4744

Is Sacral Listening Applied in a Uniform Way?
Krapp, B.
Unpublished MSc thesis, 2008/11
Free full text
4745

Modern Reception of A.T.Still´s TRIUNE MAN in Germany
Kaiser, F.
Unpublished MSc thesis, 2008/11
Free full text
4746

The living matrix: a model for the primary respiratory mechanism
Lee, R. P.
Explore (NY), 2008/11
4747

The Influence of a Mobilisation of the Lesser Omentum on the Capacity of the Portal Vein, Measured with Echo-Doppler
Halbeisen, H.
Unpublished MSc thesis, 2008/11
Free full text
4748

Spastische Diparese
(Spastic paresis)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
4749

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text
4750

Functional gestational problems and osteopathy
Steinbauer, S.
Unpublished MSc thesis, 2008/11
Free full text
4751

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
4752

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
4753

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text
4754

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text
4755

Manuelle Medizin an der Halswirbelsäule: Atraumatische Weichtechnik der Chirotherapie und HVLA-Technik der Osteopathie im Synergismus
(Manuel medicine targeting the cervical spine: Synergies between atraumatic chiropractic techniques and osteopathy's HLVA-technique)
Stahlhofer, H.
Osteopathische Medizin, 2008/11
4756

Haben osteopathische Behandlungen einen Einfluss auf die Artikulationsfähigkeit bei Vorschulkindern mit Sigmatismus / Schetismus? Eine randomisierte kontrollierte Studie
(Can osteopathic treatments improve the capability of articulation and speech of children between four and six years suffering from speech disorders (Dyslalia). A randomized controlled trial)
Beckewitz-Hübner, M., Kraus, M.
Unpublished D.O. thesis, 2008/10
4757

Osteopathische Behandlungen von Patienten mit Miktionsbeschwerden (LUTS) bei benigner Prostatahyperplasie
(Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia)
Conrad, U., Scheuer, K.
Unpublished D.O. thesis, 2008/10
4758

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10
4759

Der Einfluss der osteopathischen Behandlung bei funktioneller Stimmstörung. Eine randomisierte kontrollierte Studie
(The Influence of Osteopathic Treatment in Functional Vocal Dysfunction. A randomized controlled trial)
Fleischer, F., Weese, P.
Unpublished D.O. thesis, 2008/10
4760

Empathie und Osteopathie. Eine Begriffsbestimmung der Empathie und eine Untersuchung der Empathiefähigkeit und deren Bedeutung im Therapeuten-Patienten-Verhältnis derzeit tätiger Osteopathen
(Empathy and Osteopathy. A systematic review and cross-sectional survey)
Hähn-Jakobs, C.
Unpublished D.O. thesis, 2008/10
4761

Patients' perceptions and satisfaction with treatment in a UK osteopathic training clinic
Strutt, R., Shaw, Q., Leach, J.
Manual Therapy, 2008/10
4762

Osteopathische Behandlung des Icterus neonatorum bei gesunden Neugeborenen. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of the neonatal jaundice of the healthy newborn. A randomised controlled trial)
Kenter, A., Schmieder, S.
Unpublished D.O. thesis, 2008/10
4763

Die osteopathische Behandlung von Frauen mit Descensus uteri
(Osteopathic treatment of women with uterine prolapse. A randomized controlled trial)
Kocheise-Miller, B, Quell, K.
Unpublished D.O. thesis, 2008/10
4764

Die osteopathische Behandlung von kindlichen und juvenilen Wachstumsschmerzen. Eine randomisierte kontrollierte Studie
(The osteopathic treatment of infantile and juvenile growing pains. A randomized controlled trial)
Löhr, M., Treinies, T.
Unpublished D.O. thesis, 2008/10
4765

Die osteopathische Behandlung von Säuglingen zwischen dem 4. und 12. Lebensmonat mit kongenitaler Tränenwegsstenose. Eine randomisierte kontrollierte Studie
(The osteopathic treatment in infants (4 to 12 month) with congenital nasolacrimal duct obstruction. A randomized controlled trial)
Heinisch, M., Oberhuber, H.
Unpublished D.O. thesis, 2008/10
4766

Osteopathische Behandlung bei somatoformen autonomen Funktionsstörungen des Herz- und Kreislaufsystems
(Osteopathic treatment of patients with cardiovascular somatoform autonomic dysfunctions (SAD). A randomized controlled trial)
Mühlen, N.
Unpublished D.O. thesis, 2008/10
4767

Können osteopathische Behandlungen einen Beitrag zur Verbesserung der Symptomatik chronischer funktioneller Obstipation leisten?
(Can Osteopathic treatments afford a contribution to improve the symptoms of chronic functional constipation?)
Schulz, P., Servatius, C.
Unpublished D.O. thesis, 2008/10
4768

Intra- and Inter-Rater Reliability of the Test: Anteromedial Position of the Talus in the Talocrural Joint
Dornieden, R.
Unpublished MSc thesis, 2008/10
Free full text
4769

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text
4770

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
4771

Effectiveness of osteopathy in the cranial field and myofascial release versus acupuncture as complementary treatment for children with spastic cerebral palsy: a pilot study
Duncan, B., McDonough-Means, S., Worden, K., Schnyer, R., Andrews, J., Meaney, F. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
4772

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text
4773

Osteopathische Behandlung von Patienten mit Tinnitus und craniomandibulären Dysfunktionen
(Test-dependent osteopathic treatment of patients suffering from craniomandibular disorders (CMD) and tinnitus. A pre-post pilot trial)
Kronau, J. S., Moshövel, N.
Unpublished D.O. thesis, 2008/10
4774

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
4775

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
4776

OsteopathInnen in Österreich Bestandsaufnahme 2011 (Vollerhebung), Vergleich mit internationalen Daten und Untersuchung der Entwicklung des Berufsbildes und –standes seit 2003
(Osteopaths in Austria, 2011 extensive survey, comparison with international data and examination of the osteopathic profession's development since 2003)
Graf, B.
Unpublished MSc thesis, 2008/10
Free full text
4777

The influence of osteopathic treatments on the flexibility, technique and performance of juvenile high performance swimmers and high performance triathletes
Kattnig, W.
Unpublished MSc thesis, 2008/09
Free full text
4778

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text
4779

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text
4780

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
4781

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09
4782

Osteopathic support for a survivor of gastric cancer: A case report
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/09
4783

Osteopathen/innen und Ärzte/innen - ein Spannungsfeld ?
(Osteopaths and Physicians - An area of conflict?)
Lammer, M.
Unpublished MSc thesis, 2008/09
Free full text
4784

Aetiology of idiopathic scoliosis. Current biomedical research and osteopathic theories
Lüftinger, M.
Unpublished MSc thesis, 2008/09
Free full text
4785

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text
4786

Osteopathic treatment during immobilization of conservatively treated radial fractures in patients older than 45 years
Martschini, G.
Unpublished MSc thesis, 2008/09
Free full text
4787

Osteopathy with Enuresis
Kargl, D.
Unpublished MSc thesis, 2008/09
Free full text
4788

Back to basic science: time for another Flexner report
Weissmann, G.
FASEB Journal, 2008/09
4789

W.G.Sutherland - Seine Bedeutung in der Osteopathie einst und jetzt
William Garner Sutherland, The Founder of Cranial Osteopathy
Geppert, G.
Unpublished MSc thesis, 2008/09
Free full text
4790

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text
4791

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
4792

Osteopathic Prevention Study in Achievement-orientaded Young Soccer Players
Angleitner, C.
Unpublished MSc thesis, 2008/09
Free full text
4793

Osteopathic certification evolving into a continuous certification model
Moskowitz, J. S.
The Journal of the American Osteopathic Association, 2008/09
Free full text
4794

One hundred thousand cases of influenza with a death rate of one-fortieth of that officially reported under conventional medical treatment
Dery, M.
The Journal of the American Osteopathic Association, 2008/09
Free full text
4795

Osteopathic manipulation: promise for infantile colic
Friedman, S. J.
The Journal of the American Osteopathic Association, 2008/09
Free full text
4796

Intraobserver reliability of cranial strain patterns as evaluated by osteopathic physicians: a pilot study
Halma, K. D., Degenhardt, B. F., Snider, K. T., Johnson, J. C., Flaim, M. S., Bradshaw, D.
The Journal of the American Osteopathic Association, 2008/09
Free full text
4797

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text
4798

Can back pain caused by symptom-giving sacroiliac joint relaxation during pregnancy be reduced by applying osteopathic treatment?
Aspalter, W.
Unpublished MSc thesis, 2008/09
Free full text
4799

CV4 Alters Autonomic Balance During Paced Breathing
Ananyev, D. A., Rodriguez Jr., C., Mercado, R., Bagla, A., Seffinger, M., Wagner, E. J.
Journal of Osteopathic Medicine, 2008/08
4800

Effect of OMT in the Treatment of Initial Vascular Wall Alteration
Cerritelli, F., Carinci, F., Barlafante, G., Pizzolorusso, G., Turi, P., Cozzolino, V., Renzetti, C., Pizzolorusso, F., Orlando, F.
The Journal of the American Osteopathic Association, 2008/08
4801

Assessing Educational Impact of Osteopathic Pre-doctoral Teaching Fellows
Cross, B. M., Villanueva, R., Glover, J. C., Hiserote, R. M., Davis, G.
The Journal of the American Osteopathic Association, 2008/08
4802

The Value of Osteopathy in Anesthesiology: A Survey
Johansson, N. M., Yarmush, J., Guirguis, A., Apergis, M., Kalstein, A.
The Journal of the American Osteopathic Association, 2008/08
4803

Protective Effects of Craniocervical Osteopathic Manipulation on Cell Proliferation in the Developing Brain
LaTorre, G. N., Webster, T., Avallone, J., Hallas, B. H., Friedman, L.
The Journal of the American Osteopathic Association, 2008/08
4804

The Use of Osteopathic Manipulation to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
The Journal of the American Osteopathic Association, 2008/08
4805

Efficacy of Manipulative Treatment for Acute Low Back Pain in Active Duty Military Personnel
Stoll, S. T., Maurer, D., Hensel, K., Cruser, D.
The Journal of the American Osteopathic Association, 2008/08
4806

Use of Ultrasonography in the Preclinical Education of Osteopathic Medical Students: A Pilot Study
Syperda, V. A., Trivedi, P. N., Melo, L. C., Freeman, M. L., Ledermann, E. J., Smith, T. M., Alben, J. O.
The Journal of the American Osteopathic Association, 2008/08
4807

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4808

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4809

Bedeutung der Haut im Umgang mit Säuglingen
(Significance of the Skin when Dealing with Infants)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4810

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4811

Osteopathic medicine and community health fairs: increasing public awareness while improving public health
Stamat, H. M., Injety, K. R., Liechty, D. K., Pohlod, C. A., Aguwa, M. I.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4812

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4813

12. Europäisches Symposium der traditionellen Osteopathie – Februar 2008 auf Frauenchiemsee
(12th European Symposium of Traditional Osteopathy - February 2008 at Frauenchiemsee)
Torres, I. L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4814

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4815

Therapie über die Körperoberfläche – Anatomische und physiologische Aspekte der neurolymphatischen Reflexpunkte am Beispiel der Augen– und Ohrzonen
(Therapy via the Body Surface – Anatomical and Physiological Aspects of the Neurolymphatic Reflex Points by the Example of Eye and Ear Zones)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
Free full text
4816

Unterhautblutung
(Subcutaneous hemorrhage)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4817

Erste Ansätze in der osteopathischen Behandlung der Haut
(First Approaches in the Osteopathic Treatment of the Skin)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
4818

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4819

Osteopathic Manipulative Treatment for Postoperative Nausea and Vomiting
Schrick-Senasac, S. L., King, H. H.
The Journal of the American Osteopathic Association, 2008/08
4820

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4821

Técnica combinada de articulación y thrust para disfunción de cóndilo posterior
(The combined articular thrust technique for posterior condyle dysfunction)
Guirao Cano, D.
Osteopatía Científica, 2008/08
4822

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4823

Dolor craneofacial, craneomandibular y craneocervical. Diseño de caso único
(Craniofacial, craniocervical and/or craniomandibular pain: a single case design)
Hernández Xumet, J. E.
Osteopatía Científica, 2008/08
4824

Efectos de un protocolo secuenciado de terapia manual en los puntos gatillo latentes miofasciales de los maseteros
(Effects of a protocol of two manual techniques on latent myofascial trigger points of the masseter muscle)
Ibáñez García, J., Alburquerque Sendín, F.
Osteopatía Científica, 2008/08
4825

Posible manifestación de disfunción de la articulación temporomandibular en los estudios radiológicos quiroprácticos de las vértebras cervicales
(Possible manifestation of temporomandibular joint dysfunction on chiropractic cervical X-ray studies)
Knutson, G. A., Jacob, M.
Osteopatía Científica, 2008/08
4826

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4827

Efecto de la manipulación de la charnela occipito-atlo-axoidea en la apertura de la boca
(Effect of upper cervical spine manipulation on mouth opening)
Mansilla Ferragud, P., Boscá Gandia, J. J.
Osteopatía Científica, 2008/08
4828

Sistema estomatognático, osteopatía y postura
(The stomatognathic system, osteopathy and posture)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C.
Osteopatía Científica, 2008/08
4829

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4830

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4831

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4832

Introducing osteopathic medical education in an allopathic residency
Rubeor, A., Nothnagle, M., Taylor, J. S.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4833

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A., Showalter, A., James, C., Vawter, A., Cross, B. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
4834

Manuelle Medizin in der Pädiatrie: ein osteopathischer Ansatz: Auszüge aus dem neuen Buch: Pediatric Manual Medicine: an osteopathic approach
(Pediatric manual medicine: An osteopathic approach)
Carreiro, J. E.
Osteopathische Medizin, 2008/07
4835

Behandlung der Enuresis nocturna in der Osteopathie
(Treatment of noctural enuresis in osteopathy)
Liem, T.
Osteopathische Medizin, 2008/07
4836

Osteopathic treatment of patients with chronic non-specific neck pain: a randomised controlled trial of efficacy
Schwerla, F., Bischoff, A., Nurnberger, A., Genter, P., Guillaume, J.P., Resch, K.L.
Forschende Komplementärmedizin, 2008/07
4837

Rediscovering the classic osteopathic literature to advance contemporary patient-oriented research: A new look at diabetes mellitus
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/07
4838

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4839

Inpatient osteopathic structural examinations: is “red tape“ getting in the way of personalized patient care?
Fennig Jr., G. A., Shubrook Jr., J. H.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4840

Living in fast forward
Harper, D. L.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4841

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4842

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4843

Culture drives research funding
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4844

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text
4845

Use of inappropriate titles by New Zealand practitioners of acupuncture, chiropractic, and osteopathy
Gilbey, A.
The New Zealand Medical Journal, 2008/07
4846

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text
4847

Teaching critical thinking in osteopathy – Integrating craft knowledge and evidence-informed approaches
Fryer, G.
International Journal of Osteopathic Medicine, 2008/06/01/
4848

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06
4849

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text
4850

An Osteopathic Approach to Visceral Disease: A Case of Recurrent Urinary Tract Infection
Lerma, C., Mesisca, M., Hruby, R. J.
The AAO Journal, 2008/06
Free full text
4851

Criticality, research, scholarship and teaching: Osteopaths as educators – what makes a good teacher?
Wallace, S. S.
International Journal of Osteopathic Medicine, 2008/06
4852

Due thanks, moving forward, and valuing the journey
Vogel, S.
International Journal of Osteopathic Medicine, 2008/06
Free full text
4853

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06
4854

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text
4855

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text
4856

Place de l’ostéopathie dans la correction des déformations crâniennes du nouveau-né et du jeune enfant
(Cranial osteopathy as a complementary treatment of postural plagiocephaly)
Amiel-Tison, C., Soyez-Papiernik, E.
Archives de Pédiatrie, 2008/06
4857

Solitary fibrous pleural tumor
Jenkins, L. A., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2008/06
Free full text
4858

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text
4859

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text
4860

AAO Convocation in Dallas, Texas
Beck, M.
Osteopathische Medizin, 2008/05
4861

Osteopathische Medizin und ihre Anpassung an das Älterwerden
(Osteopathic medicine and its adjustment to aging patients)
Hruby, R.
Osteopathische Medizin, 2008/05
4862

Der Befundungsprozess in der Osteopathie
(The diagnostic process in osteopathy)
Abpfolter, M.
Unpublished MSc thesis, 2008/05
4863

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05
4864

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4865

Modified Muncie technique: osteopathic manipulation for eustachian tube dysfunction and illustrative report of case
Channell, M. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4866

Immediate effects of osteopathic manipulative treatment in elderly patients with chronic obstructive pulmonary disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4867

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4868

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4869

Practice patterns of osteopathic physicians providing end-of-life care: a survey-based study
Mason, D. C., McElrath, S., Penn-Erskine, C., Kramer-Feeley, V., Pomerantz, S. C., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4870

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4871

Osteopathische Diaphragmen und Wandlungsphasen
(Osteopathic diaphragms and transformation phases)
Wendling, D.
KIM - Komplementare und Integrative Medizin, Ärtztezeitschrift fur Naturheilverfahren, 2008/04
4872

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04
4873

Osteopathie in der Pädiatrie, Teil 3: Das Os temporale
(Osteopathy in Pediatrics, Part 3: The Temporal Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
4874

Expression of the endocannabinoid system in fibroblasts and myofascial tissues
McPartland, J. M.
Journal of Bodywork and Movement Therapies, 2008/04
4875

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text
4876

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
4877

Karpaltunnelsyndrom
(Carpal tunnel syndrome)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
4878

A.T. Still would not be proud
Fisher, C. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text
4879

Repercusiones sobre los niveles de glucosa en sangre venosa periférica, tras la manipulación con thrust del segmento vertebral T8T9 en sujetos sanos
(Effects of T8 and T9 vertebras HVT manipulations on glycemic 8 levels in peripheral venous blood in healthy people)
Durá Soler, A. M., Boscá Gandía, J. J.
Osteopatía Científica, 2008/04
4880

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text
4881

Embrace evidence...with both eyes open
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text
4882

Características de los movimientos intervertebrales y los cambios de presión intradiscal durante la manipulación de la columna lumbar: estudio de viabilidad
(Highlighting of intervertebral movements and variations of intradiskal pressure during lumbar spine manipulation: a feasibility study)
Maigne, J.Y., Guillon, F.
Osteopatía Científica, 2008/04
4883

Dolor del miembro superior, disfunción somática y deslizamiento neural
(Arm pain, somatic dysfunction and nerve movement)
Oliva Pascual-Vaca, Á.
Osteopatía Científica, 2008/04
4884

Relación entre las referencias de diagnóstico radiológico de las disfunciones osteopáticas de la cabeza humeral en el plano frontal
(Relation between diagnostic radiologic landmarks of somatic dysfunction of the humeral head in the frontal plane)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C., Solana Díaz, M. T., Rosety Rodríguez, M., Ordóñez Muñoz, F. J.
Osteopatía Científica, 2008/04
4885

Un caso de pelviespondilitis atípica
(A case of atypical pelvispondylitis)
Ricard, F.
Osteopatía Científica, 2008/04
4886

Técnica semidirecta de thrust para torsión anterior derecha del sacro: TDD
(Indirect thrust manipulation for right anterior torsion of the sacrum on a right oblique axis)
Rodríguez Blanco, C.
Osteopatía Científica, 2008/04
4887

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04
4888

Osteopathic manipulation & its use for low back pain
Wolf, C. J.
Missouri Medicine, 2008/03-04
4889

Estimation of instantaneous and cumulative loads on the low back and neck of osteopaths while performing the pre-thrust positioning for a high velocity, low amplitude thrust technique applied to the thoracic spine
Stewart, M. D.
Unpublished MSc thesis, 2008/03
Free full text
4890

Migraine and OMT
Batchelor, K., Gamber, R.
The AAO Journal, 2008/03
Free full text
4891

Osteopathic Manipulative Treatment in Pregnancy and Augmentation of Labor: A Case Report
Jones, A. L., Lockwood, M. D.
The AAO Journal, 2008/03
Free full text
4892

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text
4893

Towards an osteopathic understanding of evidence
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/03
Free full text
4894

Reliability of physical examination to assess asymmetry of anatomical landmarks indicative of pelvic somatic dysfunction in subjects with and without low back pain
Kmita, A., Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/03
4895

A short questionnaire to identify patient characteristics indicating improved compliance to exercise rehabilitation programs: A pilot investigation
Howard, D. B., Gosling, C. M. R.
International Journal of Osteopathic Medicine, 2008/03
4896

“Even though you’re choking on it, it’s all in your mind” – an osteopathic perspective on Globus Hystericus
Comeaux, Z. J.
The AAO Journal, 2008/03
Free full text
4897

Osteopathy: In Good Hands (and I don’t mean Allstate®): 2007 Northup Lecture
King, H. H.
The AAO Journal, 2008/03
Free full text
4898

Osteopathic manipulative treatment (OMT) effects on mandibular kinetics: kinesiographic study
Monaco, A., Cozzolino, V., Cattaneo, R., Cutilli, T., Spadaro, A.
European Journal of Paediatric Dentistry, 2008/03
Free full text
4899

10 Years of research in the journal: What's next?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2008/03
Free full text
4900

Clinical inquiries. Is osteopathic manipulation effective for headaches?
Keays, A. C., Neher, J. O., Safranek, S., Webb, C. W.
The Journal of Family Practice, 2008/03
4901

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4902

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4903

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03
4904

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4905

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4906

A prospective study of patients with chronic back pain randomised to group exercise, physiotherapy or osteopathy
Chown, M., Whittamore, L., Rush, M., Allan, S., Stott, D., Archer, M.
Physiotherapy, 2008/03
Free full text
4907

Does osteopathic treatment influence the hormone level of hyperandrogenaemic infertile women?
Heim, S.
Unpublished MSc thesis, 2008/02
Free full text
4908

The impact of osteopathic treatment on intraocular hypertension – an experimental study
Kuhmann, O.
Unpublished MSc thesis, 2008/02
Free full text
4909

The Use of Visceral Techniques in the Osteopathic Practices in Austria
Stemeseder, H.
Unpublished MSc thesis, 2008/02
Free full text
4910

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4911

Touch – Perception – Communication In the Context of Osteopathic Treatment
Schuster, K.
Unpublished MSc thesis, 2008/02
Free full text
4912

Health economic evaluation - An option for osteopathy?
Perndl, M.
Unpublished MSc thesis, 2008/02
Free full text
4913

Effect of osteopathic treatment on premature infants with regulation problems
Rajchl, E.
Unpublished MSc thesis, 2008/02
Free full text
4914

Communication Concept for the Austrian Osteopathic Association and the Individual Osteopath
Rüscher, M.
Unpublished MSc thesis, 2008/02
Free full text
4915

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text
4916

Osteopathie in der Pädiatrie, Teil 2: Intraossäre Läsionen des Os occipitale
(Osteopathy in Pediatrics, Part 2: Intraosseus Lesions of the Occipital Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4917

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text
4918

The Integration of Clinical Reasoning in Osteopathy
Fink-Koller, B.
Unpublished MSc thesis, 2008/02
Free full text
4919

Visceral Motility. Which osteopathic approaches are there, and how are they implemented?
Behrens, A.
Unpublished MSc thesis, 2008/02
Free full text
4920

Arterienbehandlung bei Bluthochdruck
(Arterial treatment for hypertension)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4921

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4922

Für Durchblutung sorgen - Die Behandlung von Arterien
(Providing blood circulation - The treatment of arteries)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4923

Ignorance in high places
Ha, L.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4924

Behandlung der intramuralen Gefäße der Viszera am Beispiel des Magens
(Treatment of the Intramural Vessels of the Viscera Using the Stomach as an Example)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4925

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4926

Revisiting Castlio and Ferris-Swift's experiments on direct splenic stimulation in patients with acute infectious disease
Noll, D. R., Johnson, J. C., Brooks, J. E.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4927

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4928

Debt control for young DOs
Wagner, E.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4929

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text
4930

Efficacy of the ‘Still technique’ on dorsiflexion at the talocrural joint in patients with a history of ankle injury
Taylor, N.
Unpublished MSc thesis, 2008/01
Free full text
4931

The role of osteopaths in the recognition of melanoma: attitudes, knowledge and practices in melanoma screening within the osteopathic community
Friedlander, T.
Unpublished MSc thesis, 2008/01
Free full text
4932

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01
4933

Osteopathic manipulative medicine and the athlete
Gunnar Brolinson, P., McGinley, S. M., Kerger, S.
Current Sports Medicine Reports, 2008/01
4934

Female osteopathic medical students: When the minority become the majority
Johnson, K. D.
Unpublished PhD thesis, 2008/01
4935

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text
4936

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text
4937

„Attentionality”: Osteosophische Basisschritte zur sensorischen Körper-Spiritualität in der osteopathischen Medizin
('Attentionality': Basic osteosophic steps towards a sensory spirituality of the body in osteopathic medicine)
Beuckels, J. M.
Osteopathische Medizin, 2008/01
4938

Osteopathie und Musikermedizin
(Osteopathy in musician's medicine)
Ridder, P.H.
Osteopathische Medizin, 2008/01
4939

Identification, assessment and management of mood disorders in clients by osteopathic practitioners in New Zealand
Sampath, K.
Unpublished MSc thesis, 2008/01
Free full text
4940

Quantifying Structural Changes with the Application of Osteopathic Manual Medicine (OMM) in Tegucigalpa, Honduras
Hardee, A. B.
Unpublished PhD thesis, 2008/01
Free full text
4941

Current legal framework governing manual-therapeutic osteopathic work by physiotherapists in Austria. An analysis from the perspective of self-employed physical therapists
Panovits, V.
Unpublished MSc thesis, 2007/12
Free full text
4942

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text
4943

Who are our guests?
Sumesgutner, A.
Unpublished MSc thesis, 2007/12
Free full text
4944

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text
4945

Understanding and Treating Fatigue and Gait Instability in Persons with Multiple Sclerosis: An Osteopathic Approach
Hatter, A., Williams, S.
The AAO Journal, 2007/12
Free full text
4946

Attitudes and Confidence Levels of Second-Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T. A., Fotopoulos, T. J., Best, M. A.
The AAO Journal, 2007/12
Free full text
4947

Osteopathic Manipulative Medicine and Acupuncture Combined: A Retrospective case study to determine if order of treatment makes a difference in outcome for acute mechanical low back pain
Stager, W. H.
The AAO Journal, 2007/12
Free full text
4948

Gibt es bei Patienten mit renaler Hypertonie oder essentieller Hypertonie mit begleitender Nierenschädigung somatische Dysfunktionen
(Do somatic dysfunctions occur in patients with renal or primary hypertension accompanied by kidney damage)
Gögel, F.
Unpublished MSc thesis, 2007/12
Free full text
4949

Self-reported health behaviors of osteopathic physicians
McNerney, J. P., Andes, S., Blackwell, D. L.
The Journal of the American Osteopathic Association, 2007/12
Free full text
4950

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12
4951

Is there a place for science in the definition of osteopathy?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/12
4952

Using the concept of ideomotor therapy in the treatment of a patient with chronic neck pain: A single system research design
McCarthy, S., Rickards, L. D., Lucas, N. P.
International Journal of Osteopathic Medicine, 2007/12
4953

Analysis of exercise content in undergraduate osteopathic education – A content analysis of UK curricula
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2007/12
4954

How and in what context do osteopathic medical students learn about interprofessional practice
Head French, J.
Unpublished Dissertation, 2007/12
Free full text
4955

Empathy as part of the perception process in osteopathy
Felder, R.
Unpublished MSc thesis, 2007/12
Free full text
4956

Relaxed Vision: A Clinical Study
Fitzinger, S.
Unpublished MSc thesis, 2007/12
Free full text
4957

Relationships between clinical rotation subscores, COMLEX-USA examination results, and school-based performance measures
Cope, M. K., Baker, H. H., Foster, R. W., Boisvert, C. S.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4958

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4959

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4960

Andrew Taylor Still (1828-1917): founder of osteopathic medicine
Tan, S. Y., Zia, J. K.
Singapore Medical Journal, 2007/11
4961

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4962

Schmerzsyndrome in der Regio Inguinalis
(Pain syndroms of the inguinal region)
Beck, M.
Osteopathische Medizin, 2007/10
4963

Kann mit osteopathischen Behandlungen eine Einflussnahme auf das Beschwerdebild bei Patienten mit Hyperakusis erreicht werden?
(Can osteopathic treatment influence the symptoms of patients with hyperacusis?)
Burkhardt, D., Schuff, I., Mahler, R.
Unpublished D.O. thesis, 2007/10
4964

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 3
(The craniomandibular system and its effects on the posture - Part III: Etiology, diagnosis and treatment of disorders of the CMS)
Honikel, M.
Osteopathische Medizin, 2007/10
4965

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
4966

Osteopathische Behandlung von Frauen mit Harninkontinenz nach Verletzung des Perineums unter der Entbindung. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women suffering from urinary incontinence as a result of an injury to the perineum during delivery. A randomized controlled trial)
Gerhardt, K., Montag, G.
Unpublished D.O. thesis, 2007/10
4967

The influence of an Osteopathic treatment on the performance of a high - performance athlete
Böhmüller, E.
Unpublished MSc thesis, 2007/10
Free full text
4968

Ist eine funktionelle Verbindung zwischen Diaphragma und Cranium palpierbar? Versuch der Deutung mittels des Tensegrity-Modells
(Is a functional connection between diaphragm and cranium palpatable? Attempt to interpret by means of the Tensegrity Model)
Koschella, S.
Unpublished D.O. thesis, 2007/10
4969

Survey, Systematisation and Comparison of Professional, Advanced and Continuing Training Programs for Osteopathy available in Austria in the Winter Term 2006/2007
Wilfling, E.
Unpublished MSc thesis, 2007/10
Free full text
4970

Frühkindliche Hinweise auf Lernstörungen und osteopathische Behandlungsansätze
(Signs of Learning Disorders in Early Childhood and Osteopathic Treatment Approaches)
Bierent-Vass, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4971

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4972

Behandlung eines Kindes mit Morbus Hirschsprung
(Treatment of a child with Hirschsprung's disease)
Helsmoortel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4973

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4974

Osteopathische Behandlung von Frauen mit primärer Dysmenorrhoe. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of women with primary dysmenorrhoea. A randomized controlled trial)
Pinter-Haas, A., Schach-Hirte, J., Wirthwein, P.
Unpublished D.O. thesis, 2007/10
4975

Hat die osteopathische Behandlung einen positiven Effekt bei Frauen mit persistierenden Rückenschmerzen post partum? Eine randomisierte kontrollierte Studie
(Study on the effectiveness of osteopathic treatment for women with persistent post partum back pain. A randomized controlled trial)
Recknagel, C., Roß, J.
Unpublished D.O. thesis, 2007/10
4976

Spina bifida
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4977

Osteopathische Begleitung bei frühkindlichen Fehlbildungen
(Osteopathic treatment for infantile malformations)
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4978

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
4979

Lake Erie College of Osteopathic Medicine's preclinical problem-based learning pathway program: an alternative medical school curriculum design
Ferretti, S. M., Krueger, W. A., Gabel, L. L., Curry, J. J.
The Journal of the American Osteopathic Association, 2007/10
Free full text
4980

Stellt die osteopathische Behandlung von Patienten mit chronischer Zervikalgie eine wirksame Alternative zur Physiotherapie dar? Eine randomisierte kontrollierte Studie
(Osteopathy as an efficient treatment alternative to physical therapy for patients suffering from chronic non specific neck pain? A randomized controlled trial)
Steffen, S., Tempel, R.
Unpublished D.O. thesis, 2007/10
4981

Systematische Analyse der anatomischen Verbindungen der cranialen Gefäßabgänge des Aortenbogens mit Strukturen der oberen Thorax-apertur sowie der experimentellen Überprüfung ihrer mechanischen Abhängigkeit
(Systematically research of the anatomic links of the supraaortic arteries with thoracic outlet structures and an experimental testing of their mechanical dependence)
Vogt, R.
Unpublished D.O. thesis, 2007/10
4982

Effektivität der osteopathischen Behandlung bei Patienten mit Patellofemoralen Schmerzsyndrom. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with patellofemoral pain syndrome. A randomized controlled trial)
Wendel, J., Rudisch, B., Berger, G.
Unpublished D.O. thesis, 2007/10
4983

RVUCOM: striving to meet the needs of the osteopathic medical profession
Martin, R. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
4984

Surgical workforce since the 1975 study of surgical services in the United States: an update
Sheldon, G. F.
Annals of Surgery, 2007/10
4985

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text
4986

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text
4987

Independence and Interdependence
Paulus, S. F.
The AAO Journal, 2007/09
Free full text
4988

The Establishment of a Neuromusculoskeletal-Osteopathic Manipulative Medicine Service in a 700 Allopathic Physician Practice
Richards, T. M.
The AAO Journal, 2007/09
Free full text
4989

A three-year accelerated medical school curriculum designed to encourage and facilitate primary care careers
Bell, H. S., Ferretti, S. M., Ortoski, R. A.
Academic Medicine, 2007/09
4990

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text
4991

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text
4992

Chiropractic through the eyes of physiotherapists, manual therapists, and osteopaths in the Netherlands
Langworthy, J. M., Smink, R. D.
The Journal of Alternative and Complementary Medicine, 2007/09
4993

The influence of the osteopathic treatment on the vegetative neural system.The technique “Compression of the 4th ventricle“ influences brain activity, bloodpressure, heart rate and respiration rate
Brandstötter, L., Winkler, W.
Unpublished MSc thesis, 2007/09
Free full text
4994

Three Shortcomings of Current Osteopathic Medical Education Curricula, a Student Perspective
Alvarez, R. A., Feitell, S., Jones, A. C., Landry, B. W., Mapley, A. C., Mason, C. R., Sarmiento, P. A., Schrick-Senasac, S. L.
Journal of Osteopathic Medicine, 2007/08
4995

Applicant Selection Criteria for Osteopathic Residency Programs
Ballam, G. O., Guillory, V. J.
Journal of Osteopathic Medicine, 2007/08
4996

Awareness of Health Disparities in Organ Donation among Osteopathic Medical Students
Burch, D. M., Gordon, A. R., Burnett, P. A.
The Journal of the American Osteopathic Association, 2007/08
4997

The Effect of Cranial Osteopathic Treatment on Visual Function
Caban-Martinez, A., Timoshkin, E., Sandhouse, M. E., Shechtman, D., Fecho, G., Snyder, A., Patterson, M., Shallo-Hoffmann, J., Hardigan, P.
The Journal of the American Osteopathic Association, 2007/08
4998

Zusammenhanh zwischen Kraniosakralen Techniken und Emotionaler Befindlichkeit
(Relationship between craniosacral techniques and emotional states)
Bolt, J.
Osteopathische Medizin, 2007/08
4999

Die Rolle des Ösophagus bei der Entstehung einer Plagiocephalie beim Säugling
(Role of the esophagus in the development of plagiocephaly in infants)
Kaiser, F.
Osteopathische Medizin, 2007/08
5000

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08
5001

Reproducibility Assessment of the Response to CV4 as Measured by the Laser Doppler Flowmeter and Electrocardiogram
Guinn, K. K., Rodriguez, C., Bucheli, D., Alsip, R. L., Seffinger, M., Smith, M. L.
The Journal of the American Osteopathic Association, 2007/08
5002

Measuring pressures used by physicians and students for cervical diagnosis of segmental somatic dysfunction using the Iso-TOUCH® Palpation Monitor System
Jean, N. T., Kuchera, M. L., Schoenfeldt, B., Dombrowski, R. T., Vardy, T., Williams, L.
The Journal of the American Osteopathic Association, 2007/08
5003

Prolonged Effects of Maximal Effort Exercise (with Valsalva) and Osteopathic Manipulative Treatment in Women with Multiple Sclerosis
Kuchera, M. L., Vardy, T., Yates, H., Stouch, B., Johnson, J. C.
The Journal of the American Osteopathic Association, 2007/08
5004

A Pilot Clinical Trial of Osteopathic Manipulative Treatment During Third Trimester Pregnancy
Licciardone, J. C., Buchanan, S., Fulda, K., Hensel, K., King, H. H., Stoll, S. T.
The Journal of the American Osteopathic Association, 2007/08
5005

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08
5006

Foot Ankle Biomechanics: Effects of Manipulative Intervention on Plantar Fasciitis Subjects
Morton, A. L., McGrew, A., Burns, J. M., Karodogan, E., Conatser, R. R., Howell, J. N.
The Journal of the American Osteopathic Association, 2007/08
5007

Comparing the Effects of Cranial Manipulation on Heart Rate Variability and Traube-Hering-Mayer Waves
Pexton, T., Nelson, K., Glonek, T., Heinking, K., Kappler, R., Sergueef, N.
The Journal of the American Osteopathic Association, 2007/08
5008

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08
5009

Treating the cause
Stimson, N.
British Dental Journal, 2007/08
5010

Emotionale Diagnose und Behandlung nach J.P. Barral
(Diagnosis and Treatment of Emotional Problems according to Barral)
Klein Lossing, M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
5011

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
5012

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
5013

Orthopädie und Psyche nach Verkehrsunfall
(Orthopedics and psyche after traffic accident)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
5014

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
5015

Im Gespräch mit...-Jean-Pierre Barral
(In dialog with Jean-Pierre Barral)
Seider, R., Barral, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
5016

Hope for larger study on otitis media
Galgano, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5017

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5018

Reported prevalence rates of somatic dysfunction raise an... Heel?
Kotoske, D. E.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5019

Emphasizing research in osteopathic medical education
Martin, K. D.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5020

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5021

Study on recurrent otitis media: potential value vs actual value of OMT
Orenstein, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5022

Getting back to the country
Ortolon, K.
Texas Medicine, 2007/07
5023

Trichotillomania: a rare but serious disorder
Rodos, J. J.
The Journal of the American Osteopathic Association, 2007/07
Free full text
5024

Osteopathic manipulative treatment for pandemic influenza: many questions, few answers
Sanderlin, B. W., Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2007/07
Free full text
5025

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text
5026

Ehlers Danlos Syndrome: A Case Report
Kumar, A., Stoll, S. T., Hensel, K.
The AAO Journal, 2007/06
Free full text
5027

Alleviating Atypical Tender Points Through the Use of Myofascial Release of Scar Tissue
Thomas, B. P.
The AAO Journal, 2007/06
Free full text
5028

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text
5029

An observational study of motion induced in the lumbar–pelvic complex during ‘harmonic’ technique: A preliminary investigation
Waugh, J. L., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/06
5030

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text
5031

Reply to “The flawed cranial model”
Hartman, S. E.
International Journal of Osteopathic Medicine, 2007/06
5032

Researching osteopathy: Who is responsible?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/06
5033

The flawed cranial model
Maddick, A. F.
International Journal of Osteopathic Medicine, 2007/06
5034

Manuscript preparation and publication for would-be writers: An aid to disseminating osteopathic research
Mullinger, B.
International Journal of Osteopathic Medicine, 2007/06
5035

Optimising the psychological benefits of osteopathy
Williams, N. H.
International Journal of Osteopathic Medicine, 2007/06
5036

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06
5037

Eine Einführung in die Harmonischen Techniken
(An introduction to Harmonic Technique)
Lederman, E.
Osteopathische Medizin, 2007/05
5038

Harmonische Techniken - Ausgewählte Beispiele
(Harmonic technique - Selected examples of Eyal Lederman)
Lederman, E.
Osteopathische Medizin, 2007/05
5039

Symposium der traditionellen Osteopathie
(Symposium of traditional osteopathy)
Prediger, G.
Osteopathische Medizin, 2007/05
5040

Step forward to stop bird flu
Austin, D. L.
The Journal of the American Osteopathic Association, 2007/05
Free full text
5041

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text
5042

Promoting an osteopathic medical research culture
Lee, R. P.
The Journal of the American Osteopathic Association, 2007/05
Free full text
5043

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05
5044

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text
5045

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text
5046

Osteopathic focus in the biomedical sciences: A survey of biomedical science faculty at osteopathic medical schools in the United States
Ebert, D. E.
Unpublished MSc thesis, 2007/05
5047

Integration of osteopathic manipulative medicine into differential diagnosis training: A study evaluating teaching strategies and their influence on student learning
Irvine-Moore, L. R.
Unpublished MSc thesis, 2007/05
5048

Latino success stories in higher education: A qualitative study of recent graduates from a health science center
Colley, K. L.
Unpublished PhD thesis, 2007/05
Free full text
5049

Die Stille nutzen - Auszug aus der Korrespondenz zwischen Rollin Becker und Anne Wales aus den frühen Siebziger Jahren
(Using the Stillness - Excerpt from the Correspondence between Rollin Becker and Anne Wales from the Early Seventies)
Becker, R. E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
Free full text
5050

Epicondylitis humeri radialis
(Lateral epicondylitis)
Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
5051

Das 11. Europäische Symposium der traditionellen Osteopathie
(The 11th European Symposium of Traditional Osteopathy)
Prediger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
5052

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
5053

Der verletzte Ellbogen - Überlegungen aus orthopädischer und osteopathischer Sicht
(Elbow Trauma - Considerations from an orthopedic and osteopathic point of view)
Schleusener, R., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
5054

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
5055

Treatment of Primary Raynaud`s Syndrome with Osteopathy
Kalcakosz-Takacs, T.
Unpublished MSc thesis, 2007/03
Free full text
5056

Infantile postural asymmetry and osteopathic treatment: A randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2007/03
Free full text
5057

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
5058

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text
5059

Dysgnathia as a correlative to an SBS – Lesion?
Krenner, E.
Unpublished MSc thesis, 2007/03
Free full text
5060

The Immediate Influence of Osteopathic Treatment on the Parametres of Bodyplethysmography in Patients Suffering From Cystic Fibrosis
Neuhaus, S.
Unpublished MSc thesis, 2007/03
Free full text
5061

Local Listening - a General Diagnostic Tool? An Experimental Examination of its Reliability
Podlesnic, W.
Unpublished MSc thesis, 2007/03
Free full text
5062

Klinische Osteopathie Bestandsaufnahme und Stellenwert der klinischen Arbeit in der Osteopathie
(Clinical Osteopathy)
Mayer-Fally, E.
Unpublished MSc thesis, 2007/03
Free full text
5063

The effects of the craniosacral work on the notochord on the right-left strain and the forefeet-heel strain in an upright position
Neubauer, C.
Unpublished MSc thesis, 2007/03
Free full text
5064

Cervicobrachialgia. Efficiency and Effectiveness of Osteopathic Treatment in Comparison with Conventional Ultrasound Therapy
Rumer, H.
Unpublished MSc thesis, 2007/03
Free full text
5065

A Case Study on the Osteopathic Approach to Chronic Low Back Pain and Radiculopathy
Schmied, A.
Unpublished MSc thesis, 2007/03
Free full text
5066

The Influence of Osteopathic Treatment on Postpuncture Complaints
Stephanides, A.
Unpublished MSc thesis, 2007/03
Free full text
5067

Matched-Controlled Pilot-Study: Influence of Osteopathic Treatment (Diagnostic Touch Technique) on Fatigue in a Working Population
Tremel, A.
Unpublished MSc thesis, 2007/03
Free full text
5068

Wie kommen sie eigentlich zu uns? Eine quantitative Sozialstudie über die Wege, wie Patienten zu osteopathischen Behandlungen kommen
How do they end up coming to us? A quantitative social study of the journeys people take to get to osteopathy treatment
Wagner-Scheidel, B.
Unpublished MSc thesis, 2007/03
Free full text
5069

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text
5070

Teaching Osteopathic Principles in an Allopathic Environment: Osteopathic Guerrilla Warfare: 2006 Northup Lecture
Cantieri, M. S.
The AAO Journal, 2007/03
Free full text
5071

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text
5072

Management of Peptic Ulcer Disease Using Osteopathic Manipulation
Morris, H. D., Dickey, J. L.
The AAO Journal, 2007/03
Free full text
5073

The effect of cranial-sacral membrane and fluid balance technique on the autonomic nervous system using pulse rate, breathing frequency and blood pressure as indicators
Schneider, R.
Unpublished MSc thesis, 2007/03
Free full text
5074

Examination of Refraction in Myopia - An Osteopathic Treatment Approach
Bayer, C.
Unpublished MSc thesis, 2007/03
Free full text
5075

Is it possible to intensify the effect of an osteopathic treatment through automobilisation (in a structural and visceral way), regarding success of treatment and long-term result instancing chronic low back pain patients?
Bilgeri, E.
Unpublished MSc thesis, 2007/03
Free full text
5076

What is the significance of Dr. A.T. Still’s principles and philosophy in the work of Austrian osteopaths today?
Holzheu, N.
Unpublished MSc thesis, 2007/03
Free full text
5077

Osteopathy is not only a job, it is a vocation!
Forthuber, K.
Unpublished MSc thesis, 2007/03
Free full text
5078

The Influence of Osteopathic Treatment on the Performance of Hobby Runners. A Comparative Study using Osteopathic Treatment to Enhance the Performance of Hobby Runners
Haberl, F.J.
Unpublished MSc thesis, 2007/03
Free full text
5079

Does an osteopathic treatment influence the human voice?
Hempel, G.
Unpublished MSc thesis, 2007/03
Free full text
5080

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text
5081

Influencing Lung Function by Osteopathy in Idiopathic Parkinson's Syndrome
Rupp, G.
Unpublished MSc thesis, 2007/03
5082

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
5083

Osteopathic treatment versus “relaxation“ for tension-type headache
Smitherman, T. A., Nicholson, R. A., Penzien, D. B.
Headache: The Journal of Head and Face Pain, 2007/03
5084

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03
5085

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text
5086

Craniosacral Osteopathy: “Personal Perspectives of Osteopaths with several years of professional experience”
Wojna, S.
Unpublished MSc thesis, 2007/03
Free full text
5087

Comments on “Spinal manipulation in patients with disc herniation: A critical review of risk and benefit”
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03
5088

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03
5089

Beyond spinal manipulation
McClune, T.
International Journal of Osteopathic Medicine, 2007/03
5090

Physiological effects of a CV4 cranial osteopathic technique on autonomic nervous system function: A preliminary investigation
Milnes, K., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/03
5091

Reply to Comments on “Spinal manipulation in patients with disc herniation: A critical review of risk and benefit”
Snelling, N. J.
International Journal of Osteopathic Medicine, 2007/03
5092

The Impact of Osteopathic Treatment on Increased Intraocular Pressure in Primary Chronic Open-Angle Glaucoma
Bilgeri, S.
Unpublished MSc thesis, 2007/03
Free full text
5093

Osteopathic Treatment and Stress Incontinence, in Combination with Biofeedback
Brix, S.
Unpublished MSc thesis, 2007/03
Free full text
5094

Knowing the body and embodying knowledge: an ethnography of student practitioner experiences in osteopathy and homeopathy
Gale, N. K.
Unpublished PhD thesis, 2007/03
Free full text
5095

(The 3rd International Symposium on the progress in osteopathic research, October 7, 2006 in Schlangenbad)
Franke, H.
Osteopathische Medizin, 2007/02
Free full text
5096

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
5097

Osteopathie in Kenia: Ein Projekt von Care Highway International
(Osteopathy in Kenya: A project of Care Highway International)
Soriano, L. C.
Osteopathische Medizin, 2007/02
5098

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text
5099

The Decrease Of High Blood Pressure Using a Lateral Fluid Drive Techique With Concentration On the Ossa Temporalia
Krasser, W.
Unpublished MSc thesis, 2007/01
Free full text
5100

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text
5101

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text
5102

A Questionnaire to evaluate the Professional Field of Osteopathy in Austria
Krönke, K.
Unpublished MSc thesis, 2007/01
Free full text
5103

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text
5104

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text
5105

Observation Cv4-technique - Hypertension Hypertension - Osteopathic Disfunctions
Schögler, M.
Unpublished MSc thesis, 2007/01
Free full text
5106

The heart - an expanded osteopathic approach
Wagner, G.
Unpublished MSc thesis, 2007/01
Free full text
5107

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text
5108

Das Mediastinum und Intrathorakales Fasziales Release
(The mediastinum and intrathoracal fascial release)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
5109

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
5110

Mediastinum
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
5111

Das Mediastinum - der Raum zwischen den Lungenflügeln
(The mediastinum - the space between the lungs)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
5112

Das Herz: Allgemeine osteopathische Überlegungen und spezielle Ansätze in der Kinderosteopathie
(The Heart: General osteopathic reflections and special applications in pediatric osteopathy)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
5113

The significance of osteopathic interventions in the treatment of congenital hip dysplasia (Type IIa/IIb)
Ellmerer, H.
Unpublished MSc thesis, 2007/01
Free full text
5114

Manual therapy for temporomandibular disorders: A review of the literature
Kalamir, A., Pollard, H., Vitiello, A. L., Bonello, R.
Journal of Bodywork and Movement Therapies, 2007/01
5115

Osteopathy and the Breech Presentation after 30 Weeks of Gestation
Georgiades, O.
Unpublished MSc thesis, 2007/01
Free full text
5116

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text
5117

Along The Dura Mater in Patients with Multiple Sclerosis
Toth, A.
Unpublished MSc thesis, 2007/01
Free full text
5118

The influence of osteopathic treatment during gestation onto the course of delivery - a comparative study on the frequency of medical intervation during child birth
Ruspeckhofer, M.
Unpublished MSc thesis, 2007/01
Free full text
5119

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text
5120

A woman with the problem of Infertility receiving osteopathic treatment has an increased chance of becoming pregnant
Kirchmayr, M.
Unpublished MSc thesis, 2007/01
Free full text
5121

Do 3-months-old babies who have been examined osteopathically immediately after birth and / or have been treated osteopathically as a result show different patterns of behaviour considering sleep, crying fits and digestion than 3-months-old babies having had no such treatment
Urbanek, B.
Unpublished MSc thesis, 2007/01
Free full text
5122

Changing the practice of osteopaths, chiropractors and musculoskeletal physiotherapists in relation to the management of low back pain
Evans, D. W.
Unpublished PhD thesis, 2007/01
5123

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text
5124

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text
5125

OMT for Post-mastectomy Lymphedema and Rib Pain: Case Report
Bradshaw, D., Snider, K.
The AAO Journal, 2006/12
Free full text
5126

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text
5127

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12
5128

The effectiveness of non-invasive treatments for active myofascial trigger point pain: A systematic review of the literature
Rickards, L. D.
International Journal of Osteopathic Medicine, 2006/12
5129

Pelvic Pain Due to Placement of the Vaginal Cuff after Hysterectomy: Case Report and Osteopathic Manipulative Approach to Treatment
Pasquarello, G. J.
The AAO Journal, 2006/12
Free full text
5130

Erratum to “Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation” [International Journal of Osteopathic Medicine 2006;9(1):46]
McFarlane, S., Standen, C., Roy, D., McPartland, J. M.
International Journal of Osteopathic Medicine, 2006/12
5131

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text
5132

Cranial osteopathy and licensing exams: Rejoinder to Maddick and Korth
Hartman, S. E.
International Journal of Osteopathic Medicine, 2006/12
5133

Non-Operative Management of Spinal Stenosis
Greenman, P. E.
The AAO Journal, 2006/12
Free full text
5134

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text
5135

Craniosacral Therapy: The Effects of Cranial Manipulation on Intracranial Pressure and Cranial Bone Movement
Downey, P. A., Barbano, T., Kapur-Wadhwa, R., Sciote, J. J., Siegel, M. I., Mooney, M. P.
Journal of Orthopaedic & Sports Physical Therapy, 2006/11
Free full text
5136

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
5137

Interests in research electives among osteopathic medical students
Pheley, A. M., Lois, H., Strobl, J.
The Journal of the American Osteopathic Association, 2006/11
Free full text
5138

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text
5139

Craniosacral therapy and professional responsibility
Flynn, T. W., Cleland, J. A., Schaible, P.
The Journal of Orthopaedic and Sports Physical Therapy, 2006/11
Free full text
5140

Studie zur Patientenzufriedenheit mit der osteopathischen Behandlung. Eine Fragebogenaktion der ÖGO
(A study on patient satisfaction with osteopathic treatment)
Weber, K.H., Woisetschläger, G.
Osteopathische Medizin, 2006/10
5141

Kieferorthopädie im Kindes- und Jugendalter. Zahnmedizinische und osteopathische Grundlagen. Basis eines interdisziplinären Dialoges.
(Orthodontics in infancy and adolescence. Dental and osteopathic fundamentals. Basis for an interdisciplinary dialogue)
von Tümpling, U.
Unpublished D.O. thesis, 2006/10
5142

Osteopathische Behandlung von Frauen mit Rückenschmerzen während der Schwangerschaft. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women with low back pain during pregnancy. A randomized controlled trial)
van der Linde, M., Peters, R.
Unpublished D.O. thesis, 2006/10
5143

Nitric oxide and anandamide in OMT research
Stefano, G. B., Salamon, E. J.
The Journal of the American Osteopathic Association, 2006/10
Free full text
5144

Folgen des intrauterinen Gefängnis: Fußdeformitäten
(Consequences of intrauterine imprisonment: Deformities of the Foot)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
5145

Können osteopathische Behandlungen die Symptomatik des Kopfschmerzes bzw. des Kopfdrucks bei Patienten mit chronischer Rhinosinusitis (CRS) verbessern? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with Chronic Rhino sinusitis (CRS)? A randomized controlled trial)
Roos, S., Steinbauer, U., Amann, P.
Unpublished D.O. thesis, 2006/10
5146

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10
5147

Osteopathische Behandlung bei frühkindlichem Innenschielen. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of congenital and infantile esotropia)
Reimann, B., Schiedt, R.
Unpublished D.O. thesis, 2006/10
5148

Mechanisms of change: animal models in osteopathic medical research
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/10
Free full text
5149

Osteopathische Intervention bei Kindern mit sprachassoziierten Wahrnehmungsstörungen
(Can osteopathic treatment improve language associated perception disorders in infants?)
Nollmann, R., Sturhahn, F.
Unpublished D.O. thesis, 2006/10
5150

Osteopathische Behandlung bei gastroösophagealem Reflux. Eine Beobachtungsstudie
(The osteopathic treatment of gastroesophageal reflux disease (GERD) - a observational study)
Nerreter, A., Ruf, S., Höly, B.
Unpublished D.O. thesis, 2006/10
5151

Unspezifische, pseudoradikuläre Schmerzen nach lumbaler Bandscheibenoperation
(Nonspecific, pseudoradicular low back pain after lumbar nucleotomy)
Müller, P.
Unpublished D.O. thesis, 2006/10
5152

Fußschmerzen bei einem Kleinkind
(Foot pain in a young child)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
5153

Das Kiefergelenk – zahnärztliche und osteopathische Methoden im interdisziplinären Austausch. Eine systematische Literaturarbeit und Leitfaden für die osteopathische Praxis
(The temporomandibular joint: Interdisciplinary exchange between dental and osteopathic methods. A systematic review and a guideline for the osteopathic practice)
Hippel, H.
Unpublished D.O. thesis, 2006/10
5154

Wie groß ist der Erfolg einer ganzheitlich osteopathischen Behandlung bei einem subakuten (tiefen) lumbalen Rückenschmerz? Eine randomisierte kontrollierte klinische Studie.
(The effectiveness of a holistic osteopathic treatment in subacute low back pain. A randomized controlled trial)
Heinze, G.
Unpublished D.O. thesis, 2006/10
5155

Incidence of iatrogenesis associated with osteopathic manipulative treatment of pediatric patients
Hayes, N. M., Bezilla, T. A.
The Journal of the American Osteopathic Association, 2006/10
Free full text
5156

Bewusstheit für Bewegung - Die minimale Hebeltechnik und das Behandlungskonzept von Laurie Hartman
(Awareness for movement)
Franke, H.
Osteopathische Medizin, 2006/10
5157

Larsen’s Syndrome - A Case Report
Burkett, D., Gamber, R. G.
The AAO Journal, 2006/09
Free full text
5158

A comparison of selected osteopathic treatment and relaxation for tension-type headaches
Anderson, R. E., Seniscal, C.
Headache, 2006/09
5159

A problem-based learning pathway for medical students: Improving the process through action research
Chegwidden, W. R.
Annals of the Academy of Medicine Singapore, 2006/09
Free full text
5160

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text
5161

Spinal manipulation in patients with disc herniation: A critical review of risk and benefit
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/09
5162

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text
5163

Response to Hartman's “Should osteopathic licensing examinations test for knowledge of cranial osteopathy?”
Maddick, A. F., Korth, S. B.
International Journal of Osteopathic Medicine, 2006/09
5164

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09
5165

Stretch reflex and Hoffmann reflex responses to osteopathic manipulative treatment in subjects with Achilles tendinitis
Howell, J. N., Cabell, K. S., Chila, A. G., Eland, D. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
5166

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text
5167

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
5168

Palpatory Evidence for Viscero-somatic Influence upon the Musculoskeletal System
Eland, D. C.
The AAO Journal, 2006/09
Free full text
5169

The Effects of Manipulation on Ligaments and Fascia from a Fluids Model Perspective
Crow, W. T.
The AAO Journal, 2006/09
Free full text
5170

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
5171

Merilyn Johnston Brooks über ihren Vater William L. Johnston: “Er engagierte bis zu seinem Tode für das Leben“
(Merilyn Johnston Brooks about her father William L. Johnston: “He committed himself to life until his death“)
Brooks, M. J.
Osteopathische Medizin, 2006/08
5172

Attitudes, Knowledge, and Use of Osteopathic Manipulative Treatment by Osteopathic Sports Medicine Physicians: Is OMT Being Used in the Sports Arena?
Clearfield, D.
The Journal of the American Osteopathic Association, 2006/08
5173

The Effects of OMT on Median Nerve Size and Function in Patients with Carpal Tunnel Syndrome
Feathers, T. A., Foley, W. M., Panzone, J., Lyons, J. B., Stewart, P. E., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/08
5174

Retrospective Outcome Analysis of Osteopathic Manipulation in a Treatment Failure Setting
Gronemeyer, J., Audette, J. F., Drexler, J. H., Haugh, J.
The Journal of the American Osteopathic Association, 2006/08
5175

CV-4 Induced Physiological Change as Measured by Transcutaneous Laser Doppler Flowmeter
Guinn, K. K., Seffinger, M.
The Journal of the American Osteopathic Association, 2006/08
5176

Immediate Effects of Osteopathic Manipulative Treatments on Immune Function in a Healthy Population: A Pilot Study
John, J. T.
The Journal of the American Osteopathic Association, 2006/08
5177

Teaching Osteopathic Manipulative Treatment to Allopathic Family Medicine Residents: The Role of the Community Preceptor
Jorgensen, S., Quinlan, J., Soldo, T.
The Journal of the American Osteopathic Association, 2006/08
5178

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08
5179

AOA needs to reach out more
Tatum, W. O.
The Journal of the American Osteopathic Association, 2006/08
Free full text
5180

Improving Symptoms, Pain, Functioning, and Strength for Persons with Carpal Tunnel Syndrome
Meyer, P., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R.
The Journal of the American Osteopathic Association, 2006/08
5181

The Effect of CV-4 Upon Cutaneous Bloodflow Velocity
Nelson, K. E., Sergueef, N., Glonek, T.
The Journal of the American Osteopathic Association, 2006/08
5182

Chronic Obstructive Pulmonary Disease (COPD): Immediate Effects of Osteopathic Manipulative Treatment on Exercise Tolerance and Dyspnea
Pickett, C., Stoll, S. T., Cruser, D., Cipher, D. J.
The Journal of the American Osteopathic Association, 2006/08
5183

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
5184

Effectiveness of Osteopathic Manipulative Treatment for Parkinson Disease
Snider, T. C., La Croix, C., Nunnley, T., Colwell, S., Jones, L., Wilde, B., Lodge, K., Will, A., Shoup, D., Devine, W., Wechsler, N., Cooper, K., Baker, W. P.
The Journal of the American Osteopathic Association, 2006/08
5185

Osteopathic Manipulative Medicine for Carpal Tunnel Syndrome: Changes in Nerve Conduction
White, H. D., Stoll, S. T., Cruser, D., Whitesell, R., King, H. H.
The Journal of the American Osteopathic Association, 2006/08
5186

The Role of Osteopathic Manipulative Treatment in the Treatment of Fibromyalgia Syndrome
Yahnert, J. L., Hartman, R. J., Stewart, P. E., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/08
5187

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text
5188

Funktionelle Technik
(Functional technique)
Johnston, W. L.
Osteopathische Medizin, 2006/08
5189

Einleitung in die Biodynamik der kranialen Osteopathie: Ein Interview mit James Jealous, Auckland, Neuseeland
(Introduction into biodynamics of osteopathy in the cranial region: An interview with James Jealous, Auckland, New Zealand)
Jealous, J.
Osteopathische Medizin, 2006/08
5190

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08
5191

Funktionelle Technik in der Praxis
(Functional technique in practice)
Franke, H., Schmidt, S.
Osteopathische Medizin, 2006/08
5192

Changes in active mouth opening following a single treatment of latent myofascial trigger points in the masseter muscle involving post-isometric relaxation or strain/counterstrain
Blanco, C. R., de las Penas, C. F., Xumet, J. E., Algaba, C. P., Rabadan, M. F., de la Quintana, M. C.
Journal of Bodywork and Movement Therapies, 2006/07
5193

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5194

“Circle turns round“ to “allopathic osteopathy“
Wisnioski, S. W.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5195

Proof-of-concept learning: acrylic templates as empiric evidence
White, J. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5196

Nervus vestibulocochlearis (VIII.)
(Vestibulocochlear nerve)
Toth, A. B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
5197

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5198

Tracing the decline of OMT in patient care
Richardson, M. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5199

Behandlung eines temporomandibulären Problems bessert langfristig Tinnitus-Symptome
(Treatment of a temporomandibular problem improves tinnitus symptoms in the long term)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
5200

Akuter Tinnitus: Selbstheilungskräfte dominieren
(Acute tinnitus: self-healing powers dominate)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
5201

Osteopathische Therapie des chronischen Schwindels: Nutzen offen
(Osteopathic therapy of chronic vertigo: benefit unknown)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
5202

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5203

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
5204

Cochrane Library's summary of review on manipulative treatment misleading, cheats readers
Michaud, R. G.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5205

OMT: evidence, research, and practice
McCombs, T. M.
The Journal of the American Osteopathic Association, 2006/07
Free full text
5206

The osteopathic approach in the treatment of asymmetric infant
Kollingbaum-Fabian, S.
Unpublished MSc thesis, 2006/07
Free full text
5207

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
5208

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5209

In a vacuum or in a s(l)ide show: OPP in osteopathic CME programming
Beaman, R. T.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5210

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5211

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text
5212

Craniosacral manipulation question
Benor, D. J.
Explore (NY), 2006/06
5213

Was ist der „kraniosakrale Rhythmus“?
(What is the craniosacral rhythm? An article on employing craniosacral osteopathy (CSO))
von Heymann, W., Kohrs, C.
Manuelle Medizin, 2006/06
5214

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5215

Crohn’s Disease: A Case Report including the most recent Theories and Treatment Principles
Mitchell, D., Dickey, J. L.
The AAO Journal, 2006/06
Free full text
5216

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text
5217

Manipulation of Adhesive Capsulitis under Anesthesia
Hurrell, J., Speece, A. J., Williams, S. F.
The AAO Journal, 2006/06
Free full text
5218

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5219

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5220

Factors affecting the intra-examiner and inter-examiner reliability of palpation for supine medial malleoli asymmetry
Fryer, G.
International Journal of Osteopathic Medicine, 2006/06
5221

Osteopathic evaluation and manipulative treatment in reducing the morbidity of otitis media: a pilot study
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
5222

Manipulative treatment for idiopathic impotence in a 24-year-old water polo player
Crow, W. T.
International Journal of Osteopathic Medicine, 2006/06
5223

Manual therapies
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/05
5224

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5225

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5226

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5227

Will the last DO turn off the lights?
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5228

Consider osteopathic manipulation in next positional plagiocephaly research
Mills, M. V.
The Journal of Pediatrics, 2006/05
Free full text
5229

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05
5230

Immediate effects of osteopathic manipulative treatment on immune function in a healthy population: A pilot study
John, J. T.
Unpublished MSc thesis, 2006/05
5231

Osteopathic manipulative treatment of a 26-year-old woman with Bell's palsy
Lancaster, D. G., Crow, W. T.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5232

Does osteopathic manipulative treatment improve dyspnea and exercise tolerance in subjects with stable chronic obstructive pulmonary disease?
Pickett, C.
Unpublished MSc thesis, 2006/05
5233

Osteopathic physicians and disaster relief
Kloss, B., Levy, M. J.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5234

The immediate effect of OMT on a COPD population: A pilot study
Som, M.
Unpublished MSc thesis, 2006/05
5235

A preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2006/05
Free full text
5236

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5237

Osteopathic manipulative treatment is for all DOs
Cummings, C. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
5238

Continuity of thought and tradition in the discipline supported by ongoing AOA efforts
Crosby, J. B.
The Journal of the American Osteopathic Association, 2006/04
Free full text
5239

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text
5240

Was die Osteopathie „Golden Girls” zu bieten hat
(What osteopathy has to offer „Golden Girls”)
Tettambel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5241

Sind strukturelle Veränderungen behandelbar? - Pro und Contra
(Are structural changes treatable? - Pros and cons)
Seider, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5242

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5243

Whole person medicine: a definition articulated osteopathically
Rosen, M. E.
The Journal of the American Osteopathic Association, 2006/04
Free full text
5244

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5245

Polymyalgia rheumatica
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5246

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5247

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
5248

Credit where credit's due: forebears of the Osteopathic Research Center
Goldsmith, D. M.
The Journal of the American Osteopathic Association, 2006/04
5249

Recurring Limitations in OMT Research
Cardarelli, R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5250

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5251

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03
5252

An initial investigation into the possible influence of reactive oxygen species (ROS) in chronic nerve compression injuries and the effects of osteopathic manipulative therapy (OMT)
Andrews, M. A. W.
International Journal of Osteopathic Medicine, 2006/03
5253

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03
5254

Attitudes to back pain amongst musculoskeletal practitioners: differences and similarities between professional groups and practice settings using the Attitudes to Back Pain Scale—Musculoskeletal Practitioners (ABS-mp)
Vogel, S., Pincus, T., Foster, N. E., Breen, A. C., Underwood, M.
International Journal of Osteopathic Medicine, 2006/03
5255

Multidisciplinary approach to treatment in a 38-year-old female, restrained driver following injuries sustained in a rear-end collision
Rook, J. L., Auburn, A. M.
The AAO Journal, 2006/03
Free full text
5256

Faith without works
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5257

Postmastectomy lymphedema: a call for osteopathic medical research
Ota, K. S.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5258

Manipulation in the presence of cervical spinal cord compression: a case series
Murphy, D. R., Hurwitz, E. L., Gregory, A. A.
Journal of Manipulative and Physiological Therapeutics, 2006/03
5259

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text
5260

Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation
McFarlane, S., Standen, C., Roy, D.
International Journal of Osteopathic Medicine, 2006/03
5261

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text
5262

Does osteopathic treatment have an influence on the symptoms of patients with chronic prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial
Marx, S.
International Journal of Osteopathic Medicine, 2006/03
5263

The correction of vertebral joint dysfunctions changes cerebrovascular and cerebrospinal fluid functional parameters improving some Primary Respiratory Mechanism parameters
Mandara, A., Moskalenko, Y., Musicco, M.
International Journal of Osteopathic Medicine, 2006/03
5264

The temporal effect of a high velocity thrust technique to the lumbar spine on cutaneous blood flow in the lower limb, comparing smokers and non-smokers
Howard, J.
International Journal of Osteopathic Medicine, 2006/03
5265

Beyond OMT: time for a new chapter in osteopathic medicine?
Hansen, G. P.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5266

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03
5267

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5268

Solving clinical problems osteopathically
Feeko, K. J.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5269

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03
5270

What If? Thomas L. Northup Lecture, 2005
Dowling, D. J.
The AAO Journal, 2006/03
Free full text
5271

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
5272

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text
5273

A myofascial trigger point on the skull: Treatment improves peak flow values in acute asthma patients
Crow, W. T., Kasper, D.
The AAO Journal, 2006/03
Free full text
5274

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text
5275

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text
5276

Ein Interview mit Jane Carreiro, D.O.; Osteopathisch-Richtlinien für die WHO
(An interview with Jane Carreiro, D.O.; Osteopathic guidelines for the WHO)
Schmidt, S.
Osteopathische Medizin, 2006/02
5277

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text
5278

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02
5279

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text
5280

(Osteopathic treatment of newborns with sucking dysfunction)
Mahdi, S.
Osteopathische Medizin, 2006/02
Free full text
5281

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text
5282

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text
5283

Das Berufsbild Osteopathie im Großraum Bodensee
(The osteopathic profession in the region of Lake Constance)
Feurstein, D.
Unpublished MSc thesis, 2006/02
Free full text
5284

Ethische Überlegungen zur Anwendung manipulativer Therapien in Altenpflegeheimen
(Ethical considerations for the use of manipulative therapy in nursing homes for the elderly)
Buckler, D., Strait, B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
5285

The Treatment of the Subacromial Impingement Syndrome of the Shoulder by Ostheopathic Therapy or by Self-training: Results of a prospective randomised study
Anderl, E.
Unpublished MSc thesis, 2006/01
Free full text
5286

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text
5287

Hüft-Operation und Demenz
(Hip surgery and dementia)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
5288

Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2006/01
Free full text
5289

Osteopathie bei älteren Menschen und der derzeitige Stand der klinischen Forschung
(Osteopathy in the elderly and the current state of clinical research)
Noll, D. R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
5290

Plans for new conjoint certificate of added qualifications in hospice and palliative medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2006/01
5291

A phenomenological single case study of African American medical students in a predominantly White college of osteopathic medicine
Brown, T. A. Sr.
Unpublished PhD thesis, 2006/01
5292

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
5293

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text
5294

Treatment of urinary incontinence (stress-incontinence of urine) at a descensus of vagina and bladder
Gabriel, R.
Unpublished MSc thesis, 2006/01
Free full text
5295

Cranial State of Mind - Does cranial osteopathy influence the patient's state of consciousness?
Engel, R.
Unpublished MSc thesis, 2006/01
Free full text
5296

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12
5297

Osteopathic manipulative treatment of somatic dysfunction among patients in the family practice clinic setting: a retrospective analysis
Licciardone, J. C., Nelson, K. E., Glonek, T., Sleszynski, S. L., Cruser, des Anges
The Journal of the American Osteopathic Association, 2005/12
Free full text
5298

Osteopathie gestern und morgen - Medizin des 21. Jahrhunderts
(Osteopathy of the past and the present - medicine in the 21st century)
Gritsch, J.
Unpublished MSc thesis, 2005/12
5299

Use of osteopathic manipulative treatment for iliotibial band friction syndrome
Pedowitz, R. N.
The Journal of the American Osteopathic Association, 2005/12
Free full text
5300

Women in Osteopathy. A Synopsis of the Journals “DO” and “Osteopathic Medicine”
Schmid, A.
Unpublished MSc thesis, 2005/12
Free full text
5301

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12
5302

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text
5303

Osteopathic Care of Children: 2005 Scott Memorial Lecture
Steele, K. M.
The AAO Journal, 2005/12
Free full text
5304

Immediate changes in radiographically determined lateral flexion range of motion following a single cervical HVLA manipulation in patients presenting with mechanical neck pain: A case series
Fernández-de-las-Peñas, C., Downey, C., Miangolarra-Page, J. C.
International Journal of Osteopathic Medicine, 2005/12
5305

Should osteopathic licensing examinations test for knowledge of cranial osteopathy?
Hartman, S. E.
International Journal of Osteopathic Medicine, 2005/12
5306

To what should we attribute the effects of OMT?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/12
5307

The effect of training on the inter-examiner and intra-examiner reliability of the seated flexion test and assessment of pelvic anatomical landmarks with palpation
Fryer, G., McPherson, H. C., O'Keefe, P.
International Journal of Osteopathic Medicine, 2005/12
5308

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
5309

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text
5310

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
5311

Osteopathic manipulative treatment out of a horse and buggy
Tessien, R. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
5312

Allopathic family medicine residents can learn osteopathic manipulation techniques in a 1-month elective
Leiber, J. D.
Family Medicine, 2005/11
Free full text
5313

Haben osteopathische Behandlungen einen Effekt bei Patienten mit Gonarthrose im Vergleich zu physikalischer und medikamentöser Therapie? Eine randomisierte kontrollierte Studie
(How effective are osteopathic treatments to patients with gonarthritis in comparison to the two most current forms of treatment namely physiotherapy and medication. A randomized controlled trial)
Auracher, M.
Unpublished D.O. thesis, 2005/10
5314

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5315

(The Effectiveness of Muscle Energy Technique (MET). A systematic review)
Bergold-Meier, S., Franke, H.
Unpublished D.O. thesis, 2005/10
5316

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10
5317

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5318

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5319

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5320

Mobilität der Niere: Überprüfung eines osteopathischen Tests mittels Ultraschall
(Mobility of the Kidney: Evaluation of an osteopathic test with sonography)
Dillinger, W., Wülfing, M.
Unpublished D.O. thesis, 2005/10
5321

Das Menschenbild von A. T. Still:: „MAN IS TRIUNE“. Eine Untersuchung des Ursprungs von „MAN IS TRIUNE“
(A. T. Still´s Idea of Man: „MAN IS TRIUNE“. A Research of the Origin of „MAN IS TRIUNE“)
Dippon, M.
Unpublished D.O. thesis, 2005/10
5322

Osteopathische Behandlung bei Patienten mit sekundären Lymphödemen zusätzlich zur Standardtherapie. Eine Pilotstudie.
(Osteopathic treatment of patients with secondary Lymphedema in addition to standard therapy)
Dufner, B., Lacina, H.P., Lottermoser, B.
Unpublished D.O. thesis, 2005/10
5323

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5324

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung
(Osteopathic versus Orthopedic Interventions for Chronic Epicondylopathia humeri radialis: A randomized controlled trial)
Geldschläger, S.
Unpublished D.O. thesis, 2005/10
5325

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5326

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5327

Haben osteopathische Techniken der Nieren und deren Umgebung einen Einfluss auf den Blutdruck bei Patienten mit renaler Hypertonie oder essentieller Hypertonie mit begleitender Nierenschädigung? Eine Pilotstudie.
(Does osteopathic treatment of the kidneys and the surrounding tissue have an effect on blood pressure in patients with renal hypertension or essential hypertension with concomitant renal impairment? A pilot study)
Gögel, F., Mauder, C.
Unpublished D.O. thesis, 2005/10
5328

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5329

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text
5330

Effektivität der osteopathischen Behandlung von Patienten mit chronischer Achilles-Tendinopathie. Eine randomisierte kontrollierte Studie
(Can osteopathic treatments effectively influence symptoms of patients with chronic achillotendinitis? A randomized controlled trial)
Hölscher, M., Notarius, R.
Unpublished D.O. thesis, 2005/10
5331

Haben osteopathische Behandlungen einen Einfluss auf die Symptome bei Patienten mit chronischer abakterieller Prostatitis/chronischem Beckenschmerzsyndrom ? Eine randomisierte kontrollierte Studie
(Does an osteopathic treatment have an influence on the symptoms of patients with a chronic abacterial prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial)
Marx, S.
Unpublished D.O. thesis, 2005/10
5332

Wirksamkeit osteopathischer Behandlungen bei kongenitalem Torticollis im Säuglingsalter. Eine randomisierte kontrollierte Interventionsstudie
(Have osteopathic treatments a positive affect on the extent of the pathology of a congenital, muscular torticollis on infants? A randomized controlled trial)
Niggemeier, H., Wilke, H.
Unpublished D.O. thesis, 2005/10
5333

Die therapeutische Wirksamkeit osteopathischer Behandlungen bei Säuglingen und Kindern mit Atopic Dermatitis. Eine randomisierte, kontrollierte Studie.
(The therapeutic effectiveness of osteopathic treatments of babies and children with atopic dermatitis. A randomized controlled trial)
Özbay, I., Reckwerth, M.
Unpublished D.O. thesis, 2005/10
5334

Der Einfluss der osteopathischen Behandlung beim chronischen Vertigo – eine randomisierte kontrollierte Studie
(The Influence of Osteopathic Treatment at chronic Vertigo. A randomized controlled trial)
Recknagel, A., Koop, C.
Unpublished D.O. thesis, 2005/10
5335

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10
5336

Die osteopathische Medizin im Dilemma zwischen Tradition und Moderne
(Osteopathic medicine in the dilemma between tradition and modern approach)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
5337

Muskel Energie Techniken - Three visions - Ein Workshop
(Muscle energy techniques - Three visions - A workshop)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
5338

Osteopathie bei somatoformen autonomen Funktionsstörung des Herz- und Kreislaufsystems. Eine kontrollierte klinische Studie.
(Osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system)
Sauerburger, S., Zorgman, M.
Unpublished D.O. thesis, 2005/10
5339

Prospektive Studie zu den Nebenwirkungen nach osteopathischer Behandlung an der European School of Osteopathy
(A prospective study on the side-effects following osteopathic treatment at the European School of Osteopathy)
Fossum, C., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2005/10
5340

Geschichte, Modell und Wirksamkeit der MuskelEnergieTechnik: Teil 3: Wirksamkeit der MET - Eine systematische übersichtsarbeit
(History, model and effectiveness of MuscleEnergyTechnique. Part 3: The effectiveness of MET - A systematic review)
Franke, H.
Osteopathische Medizin, 2005/10
5341

Akkomodationsfähigkeit der Augen und ihre Beeinflussung durch osteopathische Behandlung bei Presbyopie – eine randomisierte kontrollierte Studie
(Accommodative ability of the eyes and its impact by a series of osteopathic treatments in presbyopia. A randomized controlled trial)
Stelzer, F.
Unpublished D.O. thesis, 2005/10
5342

Osteopathische Behandlung von Patienten mit chronischem Asthma bronchiale – eine kontrollierte klinische Pilotstudie
(Osteopathic treatment of patients with chronic bronchial asthma. A controlled clinical pilotstudy)
Zielinski, J.
Unpublished D.O. thesis, 2005/10
5343

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5344

Der fasziale Test und die Behandlung der Articulatio coxae
(The fascial test and treatment of the articulatio coxae)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5345

Automatic Shifting
Paulson, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5346

Bewegungsabhängige Schmerzen über dem Hüftgelenk
(Movement-dependent pain above the hip joint)
Profanter, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5347

Ein Osteopath auf eigenen Wegen
(An osteopath on his own paths)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5348

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5349

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
5350

Der Einfluss der osteopathischen Behandlung auf Blasenentleerungsstörungen bei Frauen. Eine kontrollierte klinische Studie
(The influence of osteopathic treatment on voiding dysfunction of female patients)
Alberts, B., Eckmann, K., Mertens, B.
Unpublished D.O. thesis, 2005/10
5351

Pelvic postural asymmetry revisited
Davidson, S. M., Juhl, J. H.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5352

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5353

Osteopathie als Chance bei Kindern mit ADS/ADHS
“Osteopathy as an opportunity for children with ADD/ADHD“
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
5354

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5355

Teacher, heal thyself
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/09
5356

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5357

Evidence base presented--and expanding--for investment in tobacco dependence curricula for osteopathic medical education
Montalto, N. J., Priester, T. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5358

Loyalty to the profession, not the AOA: evidence base necessary for member support of association policies
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5359

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5360

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5361

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
5362

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text
5363

Lower Extremity Edema: A Case Report
DeLaughter, J. P., Gamber, R. G.
The AAO Journal, 2005/09
Free full text
5364

Osteopathie als Chance für Kinder mit ADS/ADHS?
(Osteopathy as an opportunity for children with ADD/ADHD?)
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
5365

Somatische Dysfunktion - Reflektion über die Anwendung des Begriffs in der osteopathischen Praxis
(Somatic dysfunction - Reflection on the use of the term in osteopathic practice)
Comeaux, Z.
Osteopathische Medizin, 2005/09
5366

Muscle energy technique: Geschichte, Modell und Wirksamkeit, Teil 2 - Das Modell
(Muscle energy technique. History, model and effectiveness, part 2 - The model)
Franke, H.
Osteopathische Medizin, 2005/09
5367

Biologische Basis des osteopathischen Konzeptes
(Biological basis of osteopathic concepts)
Korr, I. M.
Osteopathische Medizin, 2005/09
5368

Effectiveness of cervical spine manipulation and prescribed exercise in reduction of cervicogenic headache pain and frequency: A single case study experimental design
Eldridge, L., Russell, J.
International Journal of Osteopathic Medicine, 2005/09
5369

The short term effect of atlanto-axial high velocity low amplitude manipulation with cavitation on Edge Light Pupil Cycle Time
Gosling, C. M. R., Kinross, T., Gibbons, P., Holmes, M.
International Journal of Osteopathic Medicine, 2005/09
5370

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09
5371

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09
5372

Osteopathic manipulative treatment for low back pain: a systematic review and meta-analysis of randomized controlled trials
Licciardone, J. C., Brimhall, A. K., King, L. N.
BMC Musculoskeletal Disorders, 2005/08
Free full text
5373

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text
5374

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text
5375

Effects of CV4 manipulation on oxidative stress biomarkers
Campomanes, C., Bixby, M., Shore, K., Larkin, J., Binkerd, J., Menini, T.
The Journal of the American Osteopathic Association, 2005/07
5376

Testing the effectiveness of an innovative information package on practitioner reported behaviour and beliefs: the UK Chiropractors, Osteopaths and Musculoskeletal Physiotherapists Low back pain ManagemENT (COMPLeMENT) trial
Evans, D. W., Foster, N. E., Underwood, M., Vogel, S., Breen, A. C., Pincus, T.
BMC Musculoskeletal Disorders, 2005/07
Free full text
5377

A Pilot Clinical Trial of Osteopathic Manipulative Treatment in Pregnancy
Licciardone, J. C., Buchanan, S., Pim, K. H., Cruser, D., Stoll, S. T.
The Journal of the American Osteopathic Association, 2005/07
5378

Intraocular Pressure Correlated with Osteopathic Manipulative Treatment
Nye, Z. B., Nye, D. M., Multack, R. F., Glonek, T.
The Journal of the American Osteopathic Association, 2005/07
5379

The Impact of OMM on the Management of Tension Cephalgia
Patel, A. M., Desai, G. J.
The Journal of the American Osteopathic Association, 2005/07
5380

Osteopathische Narbenbehandlung
(Osteopathic cicatrice treatment)
Mayer, J.
Osteopathische Medizin, 2005/07
5381

Zum Thema der “osteopathischen Dreifaltigkeit“
(Osteopathic trinity 2)
Meert, G. F.
Osteopathische Medizin, 2005/07
5382

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07
5383

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07
5384

Osteopathic International Alliance: Vereinigung des Osteopathischen Berufstandes
(The Osteopathic International Alliance)
Wickless, L.
Osteopathische Medizin, 2005/07
5385

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07
5386

Das stomatognathe System aus osteopathischer Sicht
(The Stomatognathic System from an Osteopathic Aspect)
Amigues, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
5387

Zusammenarbeit von Zahnarzt und Osteopath bei Kiefergelenksbeschwerden
(Collaboration between dentist and osteopath for temporomandibular joint disorders)
Fiedler, S.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
5388

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
5389

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
5390

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
5391

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text
5392

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text
5393

Cannabimimetic effects of osteopathic manipulative treatment
McPartland, J. M., Giuffrida, A., King, J., Skinner, E., Scotter, J., Musty, R. E.
The Journal of the American Osteopathic Association, 2005/06
Free full text
5394

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text
5395

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text
5396

American Academy of Osteopathy® Consensus Statement for Osteopathic Manipulation of Somatic Dysfunction under Anesthesia and Conscious Sedation
Governors, AAO Board of
The AAO Journal, 2005/06
Free full text
5397

Be Careful with this Kind of Case!
MacDonald, R. C.
The AAO Journal, 2005/06
Free full text
5398

Abreactions in Ligamentous Articular Strain
McMurrey, L., Williams, S. F.
The AAO Journal, 2005/06
Free full text
5399

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06
5400

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06
5401

Dissection of the thoracic paraspinal region – implications for osteopathic palpatory diagnosis: A case study
Fryer, G., Johnson, J.
International Journal of Osteopathic Medicine, 2005/06
5402

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06
5403

Promoting active engagement with osteopathic principles and practice in interns and residents
Cain, R. A.
The Journal of the American Osteopathic Association, 2005/05
Free full text
5404

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
5405

Sources of bias in reviews of spinal manipulation for back pain
Canter, P. H., Ernst, E.
Wiener Klinische Wochenschrift, 2005/05
5406

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text
5407

Taking osteopathic distinctiveness seriously: historical and philosophical perspectives
Osborn, G. G.
The Journal of the American Osteopathic Association, 2005/05
Free full text
5408

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
5409

Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom').
Renckens, C. N.
Nederlands Tijdschrift Voor Geneeskunde, 2005/05
5410

(Systematic review of the effects of therapy in infants with the KISS-syndrome (kinetic imbalance due to suboccipital strain))
Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom').
Saedt, E., van der Woude, B., Theunissen, P.
Nederlands Tijdschrift Voor Geneeskunde, 2005/05
5411

Facilitated oscillatory release - a dynamic method of neuromuscular and ligamentous/articular assessment and treatment
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/04
5412

Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom')
(Systematic review of the effects of therapy in infants with the KISS-syndrome (kinetic imbalance due to suboccipital strain))
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Nederlands Tijdschrift voor Geneeskunde, 2005/04
Free full text
5413

Das okulo-vestibulo-zervikale Funktionsmodell in der osteopathischen Praxis
(The oculo-vestibulo-cervico function model in the osteopathic practice)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5414

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5415

Nystagmus
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5416

Der Einfluss der osteopathischen Behandlung auf die Verkrümmung der Cornea
(The influence of osteopathic treatment on corneal curvature)
Haase, A.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5417

Tränenkanalstenose und andere Augenbeschwerden bei Kindern
(Lacrimal duct stenosis and other eye disorders in children)
Heinisch, M., Oberhuber, H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5418

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5419

Osteopathische Pilotstudie zum Offenwinkelglaukom
(Osteopathic pilot study on open-angle glaucoma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
5420

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5421

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5422

Faith versus evidence: the real question in osteopathic medicine?
Juhl, J. H., Ostrow, G. L.
The Journal of the American Osteopathic Association, 2005/03
5423

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5424

Same as it ever was
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5425

Still keeping the faith
Rubinstein, L.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5426

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03
5427

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5428

Osteopathic medical training revisited: developing tomorrow's physicians
Innes, K.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5429

The Case of a Patient with Persistent Urinary Urgency
Clark, R. C.
The AAO Journal, 2005/03
Free full text
5430

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text
5431

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
5432

Where Do We Go From Here? 2004 Thomas L. Northup Lecture
Glover, J. C.
The AAO Journal, 2005/03
Free full text
5433

Medical Coverage for the American Team at the World 24-hour Championship Race in Brno Czech Republic
Lovy, A.
The AAO Journal, 2005/03
Free full text
5434

Acute Intermittent Porphyria Mimic of Guillain-Barré Syndrome: A Case Report with the Use of Osteopathic Manipulation for Management of Pain
McClennen, E. R., Gamber, R.
The AAO Journal, 2005/03
Free full text
5435

Rolfing und Osteopathie: Form und Funktion aus der Sicht des Rolfing
(Rolfing and osteopathy: Form and function from the viewpoint of rolfing)
Flury, H.
Osteopathische Medizin, 2005/03
5436

Qualität in der Osteopathiepraxis
(Quality in osteopathy practice)
Hafen, F.
Osteopathische Medizin, 2005/03
5437

Wo steht die Osteopathische Medizin? Stand und Zukunft der Osteopathischen Medizin aus Sicht des EROP
(What is the position of osteopathic medicine? Current state and future of osteopathic medicine from the viewpoint of the European Register for Osteopathic Physicians (EROP))
Mayer, J.
Osteopathische Medizin, 2005/03
5438

Palpation und Forschung
(Palpation and research in osteopathy)
Muzzi, D.
Osteopathische Medizin, 2005/03
5439

Wie ein Osteopath die Rolfingmethode sieht
(How an osteopath looks upon the rolfing method)
Proby, J.
Osteopathische Medizin, 2005/03
5440

The effect of osteopathy in the treatment of chronic low back pain – a feasibility study
Kirk, L., Underwood, M., Chappell, L., Martins-Mendez, M., Thomas, P.
International Journal of Osteopathic Medicine, 2005/03
5441

Attitudes towards prescribing rights: a qualitative focus group study with UK osteopaths
Grundy, M., Vogel, S.
International Journal of Osteopathic Medicine, 2005/03
5442

Welcome to IJOM
Moore, A. P.
International Journal of Osteopathic Medicine, 2005/03
5443

IJOM: An international journal for an international readership
Moran, R. W., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/03
5444

An account of the development of the conceptual basis of osteopathy course at the British School of Osteopathy
Nash, K., Tyreman, S.
International Journal of Osteopathic Medicine, 2005/03
5445

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text
5446

Cranial manipulation can alter sleep latency and sympathetic nerve activity in humans: a pilot study
Cutler, M. J., Holland, B. S., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2005/02
5447

Chairman of COPT concludes debate on “hardship exception“
Opipari, M. I.
The Journal of the American Osteopathic Association, 2005/02
Free full text
5448

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text
5449

The effect of manual therapy and a home exercise program on cervicogenic headaches: A case report
Hanten, W. P., Olson, S. L., Lindsay, W. A., Lounsberry, K. A., Stewart, J. K.
Journal of Manual and Manipulative Therapy, 2005/01
5450

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01
5451

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text
5452

Rebuttal regarding the “hardship exception“
Steier, K. J.
The Journal of the American Osteopathic Association, 2005/01
5453

Osteopaths' views on prescription rights: a qualitative pilot study
Burns, R.
Unpublished MSc thesis, 2005/01
Free full text
5454

A pilot study investigating professional standardisation and harmonisation in osteopathic institutions within Europe and Australia
Hristov, A.
Unpublished MSc thesis, 2005/01
Free full text
5455

The effect of mobilisation on pressure pain thresholds in the lumbar spine
Medle, M.
Unpublished MSc thesis, 2005/01
Free full text
5456

Occupational stress and job satisfaction in recently qualified Australian osteopaths
Salter, J.
Unpublished MSc thesis, 2005/01
Free full text
5457

A study into osteopathic treatment of pregnant women in NSW and Queensland
Smith, S.
Unpublished MSc thesis, 2005/01
Free full text
5458

Sexual harassment of male osteopaths in the workplace: evidence and effect
Stone, M.
Unpublished MSc thesis, 2005/01
Free full text
5459

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
5460

An observational study of student osteopaths' measurement of arterial blood pressure by sphygmomanometry and auscultation
Tye-Smith, A.
Unpublished MSc thesis, 2005/01
Free full text
5461

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
5462

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
5463

Subakuter Rückenschmerz: Osteopathie als nützliche und kosteneffektive Ergänzung der Routinebehandlung
(Subacute spinal pain: Osteopathy as a useful and cost effecticve add-on to usual care)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
5464

Effects of osteopathic manipulative treatment on pediatric patients with asthma: a randomized controlled trial
Guiney, P. A., Chou, R., Vianna, A., Lovenheim, J.
The Journal of the American Osteopathic Association, 2005/01
Free full text
5465

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
5466

Cognitive bias in back pain patients attending osteopathy: testing the enmeshment model in reference to future thinking
Read, J., Pincus, T.
European Journal of Pain, 2004/12
5467

Don’t Raise Your Hand – Put it on the Patient
Dowling, D. J.
The AAO Journal, 2004/12
Free full text
5468

A Case Study of Left Adhesive Capsulitis Presumably Resulting from Previous Treatment with Protease Inhibitors
Lipton, J. A., Neil, M.
The AAO Journal, 2004/12
Free full text
5469

Case Study: An Osteopathic Resolution of a Neurocardiogenic Syncope
Somoano, Y., Hagopian, S.
The AAO Journal, 2004/12
Free full text
5470

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text
5471

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text
5472

Relationship of Medical Students' Pre-Matriculate Clinical Experience to Step I Medical Board Examination Scores
Laster, B. B.
Unpublished MSc thesis, 2004/12
Free full text
5473

Blagrave-Technik zur Halswirbelsäulenbehandlung
(The Blagrave procedure for the treatment of the cervical spine)
Blagrave, P.
Osteopathische Medizin, 2004/11
5474

Die sensomotorische Entwicklung des Kindes
(The sensomotoric development of the child)
Darraillans, B.
Osteopathische Medizin, 2004/11
5475

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
Free full text
5476

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5477

F. X. Mayr-Diagnostik -Therapie und Osteopathie
(F.X. Mayr diagnosis and therapy and osteopathy)
Wilde, W.
Osteopathische Medizin, 2004/11
5478

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5479

Geburtstraumatisch bedingtes Zephalhämatom
(Birth trauma-related cephalohematoma)
Fuhrmann, M., Münster, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5480

Osteopathic medical training: developing the seasoned osteopathic physician
Clark, R. C.
The Journal of the American Osteopathic Association, 2004/11
5481

Osteopathischer Dachverband endlich gegründet
(Osteopathic umbrella organization finally founded)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5482

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text
5483

“Kraniosakral”- Mythen und Fakten
(“Craniosacral” - Myths and Facts)
Resch, K.L., Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5484

Intraossäre Läsion des Sphenoids und Os temporale - Ansichten und Vorgehen von Viola Frymann
(Intraosseus lesion of the sphenoid and temporalis. Views and Procedures from Viola Frymann)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5485

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text
5486

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
5487

Kraniosakrale Osteopathie - Was ist das?
(What's craniosacral osteopathy?)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
5488

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text
5489

Einigung über Curriculum in Frankfurt
(Agreement on curriculum for osteopathic training in Germany
Schmidt, S.
Osteopathische Medizin, 2004/11
5490

The relation between thoracic paraspinal tissues and pressure sensitivity measured by a digital algometer
Fryer, G., Gibbons, P., Morris, T.
Journal of Osteopathic Medicine, 2004/10
5491

Kann die Osteopathie einen spezifischen Beitrag in der Behandlung von Kindern mit Aufmerksamkeitsstörungen ohne Hyperaktivität und mit Hyperaktivität – ADS/ADHS leisten? Eine randomisierte kontrollierte Studie
(Osteopathic treatment of children with attention deficit disorders, with or without hyperactivity (ADD/ADHD) - is there any effect? A randomized controlled trial)
Bierent-Vass, A., Lang, J., Neumann, N.
Unpublished D.O. thesis, 2004/10
5492

Kann eine osteopathische Behandlung die Dyspareunie beeinflussen?
(Can patients, suffering from Dyspareunia, expect improvement from an osteopathic treatment? A controlled and prospective trial)
Hoffmann, A., Band, I.
Unpublished D.O. thesis, 2004/10
5493

Osteopathische Behandlungen bei intramuralen Uterusmyomen – eine randomisierte klinische Studie
Osteopathic treatment for uterine leiomyomas: a randomized controlled clinical trial
Kaschowitz, G., Besse, J.P., Schwering, G.
Unpublished D.O. thesis, 2004/10
5494

Die osteopathische Behandlung von Patienten mit Coxarthrose
(The osteopathic treatment of patients with coxarthritis)
Kießling, G., Trantenroth, M.
Unpublished D.O. thesis, 2004/10
5495

Knochen und Suturen im nasomaxillären Bereich des Schädels. Entwicklung, Ossifikation, Wachstum und Mobilität
(Bones and sutures within the nasomaxillary region of the cranium: Development, ossification, growth and mobility of those bones)
Lippmann, C.
Unpublished D.O. thesis, 2004/10
5496

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text
5497

More about the use of OMT during influenza epidemics
Magoun, H. I.
The Journal of the American Osteopathic Association, 2004/10
Free full text
5498

DO outlines steps to malpractice reform
Michaud, R. G.
The Journal of the American Osteopathic Association, 2004/10
Free full text
5499

The effectiveness and efficiency of a primary care osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
5500

Effectiveness and efficiency of a primary care based osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
Free full text
5501

The influence of contraction duration in muscle energy technique applied to the atlanto-axial joint
Fryer, G., Ruszkowski, W.
Journal of Osteopathic Medicine, 2004/10
5502

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09
5503

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09
5504

Am I a carer and do I care? An exploration of the concept of care as applied to osteopathic practice
Barnes, A.
Medicine, Health Care and Philosophy, 2004/09
5505

Influenza epidemic or pandemic? Time to roll up sleeves, vaccinate patients, and hone osteopathic manipulative skills
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/09
Free full text
5506

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text
5507

Chronic Fatigue Syndrome: The Misunderstood Disease
Gregg, T., Williams, S. F.
The AAO Journal, 2004/09
Free full text
5508

The Effect of Osteopathic Manipulative Treatment on Gait Disturbance in Multiple Sclerosis Patients
Mann, J. M., Steele, K. M.
The AAO Journal, 2004/09
Free full text
5509

Lymphatic Manipulative Pump Research: A Brief Review of Literature
McMillan, S., Crow, W. T., Greene, C. H.
The AAO Journal, 2004/09
Free full text
5510

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text
5511

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text
5512

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09
5513

Initial Investigation Into The Effect of Nerve Compression Syndrome on Slow-Twitch Muscle, and Treatment With Osteopathic Manipulative Therapy (OMT)
Andrews, M. A. W.
Journal of Osteopathic Medicine, 2004/08
5514

Investigating the Effect of OMT on Circulatory Biochemical Markers
Degenhardt, B. F., Darmani, N., Towns, L., Rhodes, D. C. J., Trinh, C., Johnson, J. C.
The Journal of the American Osteopathic Association, 2004/08
5515

The Impact of Osteopathic Manipulative Treatment by Doctors Osteopathic Medicine on the Management of Low Back Pain in Physicians' Offices
Desai, G. J., Kolo, G., Sun, C.
The Journal of the American Osteopathic Association, 2004/08
5516

Kurzinterview: Silvio Castagna
(A short interview with Silvio Castagna)
Schmidt, S., Castagna, S.
Osteopathische Medizin, 2004/08
5517

Wirksamkeit der Manipulation bei der Behandlung von Lumbago: Die Gültigkeit der Schlussfolgerungen bei Metaanalysen
(Effectiveness of manipulation in the treatment of low back pain: Validity of the conclusions in metaanalyses)
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Osteopathische Medizin, 2004/08
5518

Das Selbstverständnis eines Osteopathen
(Self-image of an osteopath)
Dräger, K.
Osteopathische Medizin, 2004/08
5519

Einführung in die Aquatische Osteopathie
(Introduction to aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
5520

Fulkren in der Aquatischen Osteopathie
(Fulcrum in aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
5521

Der gastro-ösophagale Übergang in der Diagnostik und Behandlung (Teil 2)
(The esophagogastric junction in diagnosis and treatment (Part 2))
Helsmoortel, J., Hirth, T., Kleßen, H.
Osteopathische Medizin, 2004/08
5522

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08
5523

Ganz ganzheitlich als osteopathisch tätiger Physiotherapeut
(Completely comprehensive as osteopathic physiotherapist)
Meert, G. F.
Osteopathische Medizin, 2004/08
5524

Osteopathie- ein viel versprechender Ansatz zur Verbesserung der Lebensqualität bei Panikattacken
(Osteopathy - A very promising approach to improve the quality of life in persons suffering from panic attacks)
Michaud, C.
Osteopathische Medizin, 2004/08
5525

Effects of Osteopathic Manipulative Treatment on Symptom Severity and Functional Status in Carpal Tunnel Syndrome
Meyer, P. M., Stoll, S. T., Cruser, D., White, H. D., Whitesell, R., Angel, L.
The Journal of the American Osteopathic Association, 2004/08
5526

Einheitliche Ausbildungsrichtlinien für Osteopathen Einigung in greifbarer Nähe
(Standardized educational guidelines for osteopaths)
Schmidt, S.
Osteopathische Medizin, 2004/08
5527

Interview: Jane Stark
(An interview with Jane Stark)
Stark, J.
Osteopathische Medizin, 2004/08
5528

Ganz ganzheitlich: Ganzheitlichkeit der Osteopathie?
(Completely comprehensive: Comprehensiveness of osteopathy?)
Wührl, P.
Osteopathische Medizin, 2004/08
5529

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text
5530

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text
5531

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text
5532

The Effects of Cranial Osteopathic Manipulative Treatment (OMT) as Measured by Transcutaneous Oximetry
Veneziano, M. F., Seffinger, M., Gugelchuk, G.
The Journal of the American Osteopathic Association, 2004/08
5533

Ultra Marathon Performance Improves Following OMT
Weibel, J., Lovy, A., Nelson, K. E., Kappler, R., Glonek, T.
The Journal of the American Osteopathic Association, 2004/08
5534

Conclusion of frequently used unsupported by data
Smith, R. M.
The Journal of the American Osteopathic Association, 2004/08
Free full text
5535

In opposition to Resolution 42
Steier, K. J.
The Journal of the American Osteopathic Association, 2004/08
Free full text
5536

Physiologic and Anatomic Changes in Carpal Tunnel Syndrome: Is Osteopathic Manipulative Treatment an Effective Non-surgical Alternative Therapy?
White, H. D., Stoll, S. T., Cruser, D., Meyer, P. M., Whitesell, R.
The Journal of the American Osteopathic Association, 2004/08
5537

Interview: Bernhard Hartwig, DROM e.V.
(An inteview with Bernhard Hartwig, DROM e.V.)
Schmidt, S.
Osteopathische Medizin, 2004/08
5538

Interview: Marina Fuhrmann, VOD e.V.
(An interview with Marina Fuhrmann, VOD e.V.)
Schmidt, S., Fuhrmann, M.
Osteopathische Medizin, 2004/08
5539

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
5540

The effect of osteopathic manipulative treatment on immune response to the influenza vaccine in nursing homes residents: a pilot study
Noll, D. R., Degenhardt, B. F., Stuart, M. K., Werden, S., McGovern, R. J., Johnson, J. C.
Alternative Therapies In Health And Medicine, 2004/07
5541

Osteopathy in Idiopathic Parkinson Syndrome
Pelzl, R.
Unpublished MSc thesis, 2004/07
Free full text
5542

Globale integrierte Myofasziale Osteopathische Therapie (GIMFOT)
(Global integrated myofascial osteopathic therapy (GIMFOT))
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
5543

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text
5544

Fasziales Thoraxkompressionstrauma
(Fascial thoracic compression trauma)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
5545

Mobilisation der Rippen - in die ein geschränkte oder in die freie Richtung? Pro und Contra
(Mobilization of the ribs - in the restricted or in the free direction? Pros and cons)
Küttner, T., Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
5546

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text
5547

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
5548

Performance on the American Osteopathic Board of Internal Medicine certifying examination 1986-2002 of various demographic groups and the impact of AOA reentry resolutions on allopathic-trained candidates taking the examination
Slick, G. L.
The Journal of the American Osteopathic Association, 2004/07
Free full text
5549

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text
5550

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
5551

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text
5552

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
5553

Health Promotion and Disease Prevention (HPDP) Programs of Osteopathic Hospitals: A Comparative Analysis Abstract
Sinay, T., Geletta, S.
The AAO Journal, 2004/06
Free full text
5554

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung.
[Osteopathic versus orthopedic treatments for chronic epicondylopathia humeri radialis: a randomized controlled trial]
Geldschlager, S.
Forschende Komplementärmedizin, 2004/05
5555

Osteopathie und Senkung der Arbeitsunfähigkeitszeit
(Osteopathy and disability reduction)
Hack, A.
Manuelle Medizin, 2004/05
5556

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5557

Die Entwicklung und osteopathische Behandlung von Kindern
(The development and osteopathic treatment of children)
Beinborn, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5558

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5559

8. Europäisches Symposium der traditionellen Osteopathie
(8th European Symposium of Traditional Osteopathy)
Frühwein, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5560

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text
5561

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text
5562

Infantile Schluckstörungen - in die Hand des Osteopathen
(Infantile swallowing disorder: To the hands of osteopaths)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5563

Dreimonatskolik: Osteopathie klinisch klar überlegen
(Colic children: Osteopathy markedly superior)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5564

Das Okziput - ein wichtiger Aspekt der kraniosakralen Osteopathie bei Säuglingen
(Occiput: An important aspect of craniosacral osteopathy in infants)
Schwerdtner, H.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
5565

Osteopathie auf der Intensivstation
(Osteopathy in the intensive care unit)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
Free full text
5566

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text
5567

Preliminary trial of a survey instrument to detect outcomes of curriculum reform in osteopathic manipulative medicine
von Lindeman, A.
Unpublished MSc thesis, 2004/05
5568

Parental perceptions of the therapeutic effect from osteopathic manipulation or acupuncture in children with spastic cerebral palsy
Duncan, B., Barton, L., Edmonds, D., Blashill, B. M.
Clinical Pediatrics, 2004/05
5569

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04
5570

DO relates positive experience with use of integrated neuromusculoskeletal release
Connolly, T. P.
The Journal of the American Osteopathic Association, 2004/04
Free full text
5571

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text
5572

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text
5573

The effect of osteopathic manipulative medicine on pulmonary function and lung volumes in healthy adults
Bradbury, J. A.
Unpublished MSc thesis, 2004/04
5574

A presentation of stiff and painful shoulder — a case based commentary
Chemeris, A. I., Clive, B., Lathey, D., Niel-Asher, C. S.
Journal of Osteopathic Medicine, 2004/04
5575

The use of cranial osteopathy in the treatment of infants with breast feeding problems or sucking dysfunction
Wescott, N.
The Australian Journal of Holistic Nursing, 2004/04
5576

Methods used by members of the Australian osteopathic profession to assess the sacroiliac joint
Peace, S., Fryer, G.
Journal of Osteopathic Medicine, 2004/04
5577

Osteopathic emergency medicine
Anderson, G. V.
Annals of Emergency Medicine, 2004/03
Free full text
5578

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03
5579

Effectiveness of a sham protocol and adverse effects in a clinical trial of osteopathic manipulative treatment in nursing home patients
Noll, D. R., Degenhardt, B. F., Stuart, M., McGovern, R., Matteson, M.
The Journal of the American Osteopathic Association, 2004/03
Free full text
5580

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text
5581

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text
5582

Cystic Fibrosis: A Case History
Back, H. D., Gamber, R. G.
The AAO Journal, 2004/03
Free full text
5583

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text
5584

A Case of Right First Rib Somatic Dysfunction Diagnosed and Treated
Lipton, J. A., Neil, M., Drew, B., McCarty, C.
The AAO Journal, 2004/03
Free full text
5585

Inter- and intraexaminer reliability in palpation of the “primary respiratory mechanism” within the “cranial concept”
Sommerfeld, P., Kaider, A., Klein, P.
Manual Therapy, 2004/02
5586

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
5587

Sturzgeburt und fasziales System
(Precipitate labor and fascial system)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
5588

Das Meeting der World Osteopathic Health Organisation (WOHO)
(The meeting of the World Osteopathic Health Organisation (WOHO))
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
5589

AOA membership and board certification of residency graduates: comparison of three programs accepting osteopathic physicians--implications for graduate medical education
Hayes, O. W.
The Journal of the American Osteopathic Association, 2004/02
Free full text
5590

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text
5591

Strength in collaboration
Quinn, A.
The Journal of the American Osteopathic Association, 2004/02
Free full text
5592

Die Bedeutung der Faszien in der manuellen Therapie
(The importance of fasciae in manual therapy)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
5593

Wie viel Intensität braucht die Behandlung des Fasziengewebes? Pro und Contra
(How much intensity does the treatment of fascial tissue need? Pros and cons)
Schwind, P., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
5594

Outpatient osteopathic single organ system musculoskeletal exam form: training and certification
Sleszynski, S. L., Glonek, T., Kuchera, W. A.
The Journal of the American Osteopathic Association, 2004/02
Free full text
5595

Let's learn from the influenza epidemic
Richardson, M. E.
The Journal of the American Osteopathic Association, 2004/02
Free full text
5596

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text
5597

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01
5598

Osteopathic treatment for the symtomatic relief of meniere's disease
Adamek, K.
Unpublished MSc thesis, 2004/01
Free full text
5599

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain
Alivizatos, J.
Unpublished MSc thesis, 2004/01
Free full text
5600

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text
5601

Analysis of co-pathologies in 1000 patients attending an osteopathic teaching clinic
Blajer, J.
Unpublished MSc thesis, 2004/01
Free full text
5602

The effect of osteopathic treatment on lung function in children with asthma: a case study
Esnouf, M.
Unpublished MSc thesis, 2004/01
Free full text
5603

Job satisfaction and occupational stress in experienced osteopaths
Flaherty, K.
Unpublished MSc thesis, 2004/01
Free full text
5604

Spirituality and osteopathy: a practitioners' views
Huggett, S.
Unpublished MSc thesis, 2004/01
Free full text
5605

The effect of osteopathic manipulative therapy applied to the lumbar spine on postural stability: a pilot study
Jones, D.
Unpublished MSc thesis, 2004/01
Free full text
5606

An investigation of the factors underlying the choice of treatment modalities used by students in the Victoria University Osteopathic clinic and practicing osteopaths
Kennedy, L.
Unpublished MSc thesis, 2004/01
Free full text
5607

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
5608

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain
Lamaro, J.
Unpublished MSc thesis, 2004/01
Free full text
5609

The effect of training on the inter-examiner and intra-examiner reliability of static palpation for assessing pelvic landmarks
McPherson, H. C.
Unpublished MSc thesis, 2004/01
Free full text
5610

Identifying the major issues of rural osteopathic practice from the practitioner's perspective
Moritz, S.
Unpublished MSc thesis, 2004/01
Free full text
5611

Discussion and literature review of primary respiration
Mahal, J.
The Journal of the American Osteopathic Association, 2004/01
Free full text
5612

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
5613

The perceived effect that part-time work has on undergraduate and postgraduate osteopathic students
Nolle, C.
Unpublished MSc thesis, 2004/01
Free full text
5614

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text
5615

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
5616

Osteopathic treatment to patients with primary dysmenorrhea
Pirritano, R.
Unpublished MSc thesis, 2004/01
Free full text
5617

The effect of osteopathic treatment on the irritable bowel syndrome: a case series
Stasiuk, D.
Unpublished MSc thesis, 2004/01
Free full text
5618

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text
5619

The efficacy of the osteopathic manipulative medicine pre-doctoral fellowship program at the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center
McCurdy, E. N.
Unpublished MSc thesis, 2004/01
5620

Randomized osteopathic manipulation study (ROMANS): pragmatic trial for spinal pain in primary care
Williams, N. H., Wilkinson, C., Russell, I., Edwards, R. T., Hibbs, R., Linck, P., Muntz, R.
Family Practice, 2003/12
Free full text
5621

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
5622

Bedside cardiology skills training for the osteopathic internist using simulation technology
Issenberg, S. B., Gordon, M. S., Greber, A. A.
The Journal of the American Osteopathic Association, 2003/12
Free full text
5623

Osteopathic manipulative treatment in prenatal care: a retrospective case control design study
King, H. H., Tettambel, M. A., Lockwood, M. D., Johnson, K. H., Arsenault, D. A., Quist, R.
The Journal of the American Osteopathic Association, 2003/12
Free full text
5624

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text
5625

Osteopathic physicians in primary care, Texas, 2003
Miller, T. L.
Unpublished MSc thesis, 2003/12
5626

Neuromusculoskeletal Medicine/ OMM: Useful to ALL DOs
van Buskirk, R. L.
The AAO Journal, 2003/12
Free full text
5627

Inclusion of evidence-based medicine in colleges of osteopathic medicine and suggestions for implementing evidence-based medicine into osteopathic medical school curricula
Cundari, A. D., Ker, N.
The Journal of the American Osteopathic Association, 2003/11
Free full text
5628

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text
5629

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text
5630

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11
5631

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text
5632

Osteopathie hilft bei Prävention & Reha
(Osteopathy helps in prevention and rehabilitation)
Schaa, J.
Pflege Aktuell, 2003/11
5633

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text
5634

Position-Assisted Combination Technique (PACT) in the Management of Type-II Impairment in the Thoracic and Lumbar Spine
Makofsky, H. W.
Journal of Manual and Manipulative Therapy, 2003/10
5635

The effect of muscle energy technique on hamstring extensibility: the mechanism of altered flexibility
Ballantyne, F., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/10
5636

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10
5637

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10
5638

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10
5639

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10
5640

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
5641

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text
5642

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text
5643

Osteopathische Behandlung infantiler Schluckstörungen bei Kindern zwischen sieben und elf Jahren
(Osteopathic treatment of infantile swallowing for children between 7 and 11 years)
Bayer, S., Feldt, M.
Unpublished D.O. thesis, 2003/10
5644

Hat die osteopathische Behandlung bei Frauen mit menstrueller Migräne einen Effekt?
(The osteopathic treatment of menstrual migraine)
Ecker, H., Thomas, C.
Unpublished D.O. thesis, 2003/10
5645

Os sphenoidale und Os ethmoidale – Entwicklung, Verknöcherung und Frage nach der Möglichkeit einer Mobilität
(Sphenoid bone and Ethmoid bone – Development, Ossification and the Question of a possible Mobility)
Eser-Bindl, U.
Unpublished D.O. thesis, 2003/10
5646

Study to evaluate osteopathic treatment in late whiplash syndrome
(Study to evaluate osteopathic treatment in late whiplash syndrome)
Gietz, R., Kaiser, A., Kastner, K.
Unpublished D.O. thesis, 2003/10
5647

Die osteopathische Behandlung bei 3- Monatskolik im Vergleich zur konventionellen Therapie
(Osteopathic treatment of infantile colic)
Heber, U., Senger, A.
Unpublished D.O. thesis, 2003/10
5648

Pilotstudie zur Untersuchung der Wirksamkeit der osteopathischen Tuba auditiva Technik bei akuten Tinnituspatienten mit und ohne Hörstörungen
(Randomized clinical trial to investigate the efficacy of osteopathic tuba auditiva technique in acute tinnitus patients with and without hearing disorders - a pilot study.)
Mayer, M.
Unpublished D.O. thesis, 2003/10
5649

Osteopathie als Therapie der Säuglingsasymmetrie: Eine randomisierte kontrollierte Studie
(Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial)
Pabst, B., Schleupen, A.
Unpublished D.O. thesis, 2003/10
5650

Viewpoint
Chaitow, L.
Journal of Osteopathic Medicine, 2003/10
5651

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
5652

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
5653

Osteopathische Begleitung während der Schwangerschaft
(Osteopathic support during pregnancy)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
5654

Osteopathie in der Schwangerschaft: Profitieren Mutter und Kind?
(Osteopathy in pregnancy: positive impact on mother and child?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
5655

Osteopathie bei Zwillingsschwangerschaft
(Osteopathy in twin pregnancy)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
5656

Behandlung von Symphysis pubis, knöchernem Becken und Beckenboden
(Treatment of symphysis pubis, bony pelvis and pelvic floor)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
5657

Place de l’acupuncteur et du thérapeute manuel dans la prise en charge pluridisciplinaire des douloureux chroniques
(Place of acupuncturist and osteopath in multidisciplinary chronic pain management)
Meas, Y., Nizard, J., Rouxeville, Y., Lajat, Y.
Douleur et Analgesie, 2003/09
5658

Muscle energy technique in patients with acute low back pain: a pilot clinical trial
Wilson, E., Payton, O., Donegan-Shoaf, L., Dec, K.
Journal of Orthopaedic & Sports Physical Therapy, 2003/09
5659

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text
5660

Principles from evolutionary biology and psychology will further strengthen tenets and profession
Pohlod, C. A.
The Journal of the American Osteopathic Association, 2003/09
Free full text
5661

Productivity outcomes for recent grants and fellowships awarded by the American Osteopathic Association Bureau of Research
Rose, R. C., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2003/09
Free full text
5662

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text
5663

Objectively and subjectively observed changes in patients diagnosed with primary coxarthrosis following osteopathic treatment with and without supplemental glucosaminosulfate and MSM
Bergthaler, H.
Unpublished MSc thesis, 2003/09
5664

Letters to the editor
Ehrenfeuchter, W. C., Kellam, R. T.
The AAO Journal, 2003/09
Free full text
5665

Facilitated Oscillatory Release - a method of dynamic assessment and treatment of Somatic Dysfunction
Comeaux, Z. J.
The AAO Journal, 2003/09
Free full text
5666

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text
5667

“The Energy cyst“: Its Ramifications and Use in Osteopathic Manipulative Management
MacDonald, R. C.
The AAO Journal, 2003/09
Free full text
5668

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text
5669

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text
5670

Osteopathic manipulation to prevent otitis media--does it work?
Pichichero, M. E.
Archives of Pediatrics & Adolescent Medicine, 2003/09
5671

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08
5672

Patient-reported Outcomes of Osteopathic Manipulative Treatment, The Development of a Research Tool
Caldwell, C. T., Degenhardt, B. F., Johnson, J. C., Hoberman, C. J.
The Journal of the American Osteopathic Association, 2003/08
5673

Determining the Impact of Osteopathic Manipulative Therapy in the Management of Irritable Bowel Syndrome
Chiesa, J. C., Pomerantz, S. C., Shinkle, J. W., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08
5674

Cranio-Sacral CV-4 Can Decrease Sleep Latency In Healthy Humans
Cutler, M. J., Holland, B. S., Gamber, R. G., Smith, M. L.
The Journal of the American Osteopathic Association, 2003/08
5675

Study raises important issues about the potential benefit of osteopathy in the cranial field to patients with Parkinson's disease
Boehm, K. M., Lawner, B. J., McFee, R. B.
The Journal of the American Osteopathic Association, 2003/08
Free full text
5676

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
5677

Die Wirksamkeit des multimodalen (manualtherapeutischen, osteopathischen) Therapiekonzeptes bei Kindern mit infantiler Cerebralparese
(The effectiveness of multimodal therapy concepts in children with cerebral palsy)
Steingrube-Bradtke, E.
Kranken Gymnastik, 2003/08
5678

Benefits of Osteopathic Manipulative Treatment After Abdominal Hysterectomy: A Retrospective Cohort Study
Ludwig, K., Hortos, K., Gupte, C.
The Journal of the American Osteopathic Association, 2003/08
5679

Osteopathic Manipulative Therapy (OMT) as a Non-pharmacological Treatment for Stable Patients with Emphysema and Chronic Bronchitis
Morley, T. F., Shinkle, J. W., Pomerantz, S. C., Ciesielski, J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2003/08
5680

Hemodynamic Effects of Osteopathic Manipulative Treatment (OMT) Immediately Following Coronary Artery Bypass Graft (CABG) Surgery
O-Yurvati, A. H., Carnes, M., Clearfield, M., Stoll, S. T., McConathy, W.
The Journal of the American Osteopathic Association, 2003/08
5681

Determination of Pressures Used in Osteopathic Manipulative Treatments
Patterson, M. M., Shamus, E., Carter, K.
The Journal of the American Osteopathic Association, 2003/08
5682

Osteopathic Manipulative Treatment and Congestive Heart Failure
Scheunemen, G. M., Mnabhi, A. K. S., Papp, M. A., Nelson, K. E., Glonek, T.
The Journal of the American Osteopathic Association, 2003/08
5683

Cranial Manipulation Induces Sequential Changes in Blood-Flow Velocity, on Demand
Sergueef, N., Nelson, K. E., Glonek, T.
The Journal of the American Osteopathic Association, 2003/08
5684

Lumbar Rotation Range of Motion with Lumbar Osteopathic Manipulative Treatment
Shamus, E., Patterson, M. M., Carter, K.
The Journal of the American Osteopathic Association, 2003/08
5685

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text
5686

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07
5687

Do osteopathic physicians differ in patient interaction from allopathic physicians? An empirically derived approach
Carey, T. S., Motyka, T. M., Garrett, J. M., Keller, R. B.
The Journal of the American Osteopathic Association, 2003/07
Free full text
5688

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text
5689

Osteopathic manipulative treatment for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Stoll, S. T., Fulda, K. G., Russo, D. P., Siu, J., Winn, W., Swift, J.
Spine (Phila Pa 1976), 2003/07
5690

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text
5691

Cranial manipulation with possible neurovascular contact injury at the cerebello-pontine angle: a case report
Elliott, J. M., Jacobson, E. J., Centeno, C. J., Emerson, P. L.
Alternative Therapies in Health and Medicine, 2003/07
5692

ACO Risk Management for Chiropractors and Osteopaths: Imaging Guidelines for Conditions Commonly Seenin Practice
French, S., Walker, B. F., Cameron, M., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D., Comrie, D. A.
Australasian Chiropractic & Osteopathy, 2003/07
Free full text
5693

Schlüsselfunktionen des Peritoneums bei Rückenschmerzen
(Key functions of the peritoneum in back pain)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
5694

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
5695

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
5696

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
5697

Nackenschmerzen: Manualtherapie am günstigsten
(Cost-effectiveness of common treatments for neck pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
5698

Die Viszera - Konsequenzen aus der Autonomie für die Osteopathie? Pro und Contra
(The viscera - consequences of autonomy for osteopathy? Pros and cons)
Wührl, P., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
5699

Osteopathic physicians provide quality care--with or without OMT
Crow, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
5700

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text
5701

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
5702

Awareness and use of osteopathic physicians in the United States: results of the Second Osteopathic Survey of Health Care in America (OSTEOSURV-II)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/06
Free full text
5703

OMT's effectiveness already proven
Tessien, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
5704

Die Klavikula
(The clavicle. The key to the shoulder)
Hack, A.
Manuelle Medizin, 2003/06
5705

Osteopathic Manipulative Management of Herpes Zoster (Shingles} and the Prevention of Post Herpetic Neuralgia
Kellam, R. T.
The AAO Journal, 2003/06
Free full text
5706

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text
5707

OMT Relieves Jaw Pain
Pasquarello, G.
The AAO Journal, 2003/06
Free full text
5708

Somatovisceral response following osteopathic HVLAT: a pilot study on the effect of unilateral lumbosacral high-velocity low-amplitude thrust technique on the cutaneous blood flow in the lower limb
Karason, A. B., Drysdale, I. P.
Journal of Manipulative and Physiological Therapeutics, 2003/05
5709

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2003/05
Free full text
5710

The effect of muscle energy technique on gross trunk range of motion
Lenehan, K. L., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/04
5711

Research at US colleges of osteopathic medicine: a decade of growth
Guillory, V. J., Sharp, G.
The Journal of the American Osteopathic Association, 2003/04
Free full text
5712

Regarding the editorial on tobaccoism
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/04
5713

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04
5714

Praktische osteopathische Überlegungen zu den Nasennebenhöhlen
(Practical osteopathic considerations for the paranasal sinuses)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5715

Osteopathie bei chronischer Sinusitis
(Osteopathy for chronic sinusitis)
Häfner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5716

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5717

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5718

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5719

Wissenswertes zum Bereich von Hals, Nase und Ohren
(Things to know about the area of the throat, nose and ears)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5720

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5721

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
5722

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text
5723

A proposal that benefits all
Bentley, E. M.
The Journal of the American Osteopathic Association, 2003/03
Free full text
5724

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text
5725

Osteopatia in neonatologia
(Osteopathy in neonatology)
Colli, R., Biagiotti, I., Sterpa, A.
La Pediatria medica e chirurgica : Medical and surgical pediatrics, 2003/03
5726

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text
5727

Characteristics of physicians disciplined by the State Medical Board of Ohio
Clay, S. W., Conatser, R. R.
The Journal of the American Osteopathic Association, 2003/02
Free full text
5728

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text
5729

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text
5730

Spinal manipulation for low-back pain: a treatment package agreed to by the UK chiropractic, osteopathy and physiotherapy professional associations
Harvey, E., Burton, A. K., Moffett, J. K., Breen, A.
Manual Therapy, 2003/02
5731

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02
5732

Alternative treatments for neck sprain
Hogg, K., Morton, R.
Emergency Medicine Journal, 2003/01
5733

Benefits of osteopathic schools
Blackstone, E. A.
Health Affairs, 2003/01
5734

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text
5735

Use of osteopathic manipulative treatment by Ohio osteopathic physicians in various specialties
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2003/01
Free full text
5736

A pilot study of the fundamental elements of osteopathic diagnosis as currently taught in the osteopathy course at Victoria University
Chisari, M.
Unpublished MSc thesis, 2003/01
Free full text
5737

Osteopathic treatments and the techniques used in the treatment of acute mechanical low back pain
Daskalou, D.
Unpublished MSc thesis, 2003/01
Free full text
5738

What is the relationship between indicators of stress and academic performance in third year university students: a follow up study
Flint, D.
Unpublished MSc thesis, 2003/01
Free full text
5739

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text
5740

A study of physiotherapists' and chiropractors' knowledge and opinions of osteopaths
Hough, N.
Unpublished MSc thesis, 2003/01
Free full text
5741

Sacroiliac joint assessment within the Australian osteopathic profession
Peace, S.
Unpublished MSc thesis, 2003/01
Free full text
5742

Re-discovery of self: the impact of osteopathic treatment on women who suffer from perimenstrual low backache
Lonergan, B.
Unpublished PhD thesis, 2003/01
5743

The impact of curricular reform on student opinions of their osteopathic manipulative medicine education
Niedzwecki, C. M.
Unpublished MSc thesis, 2003/01
5744

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text
5745

Evaluation de la frequence des accidents lies aux manipulations vertebrales a partir d'une enquete retrospective realisee dans quatre departements francais
(Complications following vertebral manipulation-a survey of a French region physicians)
Dupeyron, A., Vautravers, P., Lecocq, J., Isner-Horobeti, M. E.
Annales de Réadaptation et de Médecine Physique, 2003/01
5746

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01
5747

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
5748

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
5749

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
5750

Kompensatorische Kniebeschwerden
(Compensatory knee pain)
Schallier, F., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
5751

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
5752

Perceptions of philosophic and practice differences between US osteopathic physicians and their allopathic counterparts
Johnson, S. M., Kurtz, M. E.
Social Science & Medicine, 2002/12
Free full text
5753

From the Archives: Untitled Talk
Sutherland, W. G.
The AAO Journal, 2002/12
Free full text
5754

Social Capital and Osteopathic Medicine in Transition
Ward, R. C.
The AAO Journal, 2002/12
Free full text
5755

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text
5756

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11
5757

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5758

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5759

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11
5760

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5761

Parameters of asthma and manipulation study questioned
Cali, G. E.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5762

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5763

Relationship of osteopathic medical licensure examinations with undergraduate admission measures and predictive value of identifying future performance in osteopathic principles and practice/osteopathic manipulative medicine courses and rotations
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5764

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5765

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5766

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5767

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11
5768

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text
5769

Die osteopathische Behandlung der chronischen Zervikalgie. Eine randomisierte kontrollierte Studie
(Osteopathy alleviates pain in chronic non-specific neck pain: A randomized controlled trial)
Bischoff, P., Nürnberger, A., Voigt, A.
Unpublished D.O. thesis, 2002/10
5770

Hat eine osteopathische Behandlung einen Effekt bei Kindern mit Hyperaktivität und/oder eines Aufmerksamkeits-Defizitsyndroms.
(Can osteopathic treatment have an effect on children with Attention Deficit Hyperactivity Disorder Syndrome (ADHD) and/or Attention Disorder Syndrome (ADD)? A randomized controlled trial.)
Haas, J, Käser, D, Werner, M
Unpublished D.O. thesis, 2002/10
5771

Studie zur osteopathischen Behandlung der Dranginkontinenz und der Kombination aus Stress- und Dranginkontinenz bei Frauen
(Study on osteopathic treatment of urge incontinence and the combination of stress and urge incontinence in women.)
Ernst, H., Osenstätter, H.
Unpublished D.O. thesis, 2002/10
5772

Kann durch osteopathische Techniken eine Senkung des Augeninnendrucks beim primärchronischen Offenwinkelglaukom bewirkt werden? [Pilotstudie]
(Is it possible through osteopathic techniques to get a reduction of intraocular pressure in primary open-angle glaucoma? (pilot study))
Esser, T.
Unpublished D.O. thesis, 2002/10
5773

Common Mother-Infant Treatment. A Way to Attachment Security
Kreutz, M.
Unpublished MSc thesis, 2002/10
5774

Osteopathie und chronische Sinusitis: Eine randomisierte kontrollierte Pilotstudie
(Osteopathic treatment of chronic sinusitis: a randomized controlled pilot trial)
Häfner, S., Stadler, M.
Unpublished D.O. thesis, 2002/10
5775

Untersuchung der Reproduzierbarkeit osteopathischer Tests am Beispiel des Beckens
(Study of the reproducibility of osteopathic tests using the pelvis as an example.)
L, Monteiro-Ferreira J. Rößel-Bretschneider A. Thuillier
Unpublished D.O. thesis, 2002/10
5776

Einfluss osteopathischer Behandlungen auf Konzentrationsstörungen bei Kindern [Pilotstudie]
(Effect of osteopathic treatments on concentration disorders in children. A pilot study)
Lamberts, A.
Unpublished D.O. thesis, 2002/10
5777

Osteopathische Behandlung im Bereich des Caecums und die Wirkung auf den Rückfluss der Vena femoralis bei Patientinnen mit Venenproblemen
(Osteopathic treatment in the caecum and the effect on the reflux of the femoral vein in patients with venous problems)
Ritter-Kleinhans, M.
Unpublished D.O. thesis, 2002/10
5778

Die therapeutische Wirksamkeit einer osteopathischen Behandlung beim Reizdarmsyndrom: Eine randomisierte kontrollierte Studie
(Osteopathy as a promising short-term strategy for irritable bowel syndrome: randomized controlled trial)
Müller, A., Salomon, J., Stiedl, M.
Unpublished D.O. thesis, 2002/10
5779

Einfluss osteopathischer Techniken auf den Heilungsverlauf einer Hüftreifestörung (Dysplasie) im Säuglingsalter
(Influence of osteopathic techniques on the healing process of a hip maturation disorder (dysplasia) in infancy)
Remmele, R., Weiss, R.
Unpublished D.O. thesis, 2002/10
5780

Stellt die osteopathische Therapie bei der chronischer Tubenbelüftungsstörung von Kindern eine Alternative zur üblichen chirurgischen Behandlung dar? [Pilotstudie]
(Is osteopathic therapy an alternative to standard surgical treatment for chronic impaired tubal ventilation in children? A pilot study.)
Schiefer, B., Weis-Ayari, M.
Unpublished D.O. thesis, 2002/10
5781

An investigation into the electrical activity of tender, resting paraspinal muscles using surface electromyography: a pilot study
Hubbard, A., Fryer, G., Ball, K. T.
Journal of Osteopathic Medicine, 2002/10
5782

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text
5783

Conditions and diagnoses for which osteopathic primary care physicians and specialists use osteopathic manipulative treatment
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2002/10
Free full text
5784

A critical appraisal of an article comparing the effectiveness of osteopathic manipulation and chemonucleolysis in the management of symptomatic lumbar disc herniation
Legge, D.
Journal of Osteopathic Medicine, 2002/10
5785

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10
5786

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10
5787

A retrospective case report of symphysis pubis dysfunction in a pregnant woman
Cassidy, I., Jones, C.
Journal of Osteopathic Medicine, 2002/10
5788

Research Interests and Motivations Among Osteopathic Medical Students: Results of a Pre-Clinical Student Survey
Licciardone, J. C., Fulda, K., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/09
5789

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text
5790

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text
5791

Post-traumatic Headache of Cervical Origin
Mitra, M. M., Stoll, S. T.
The AAO Journal, 2002/09
Free full text
5792

Osteopathic Manipulative Treatment and Task Specific Practice Enhance Locomotor Recovery after Unilateral Sensorimotor Cortex Lesions in Rats
Schmanke, T., Rosario, H., Chughtai, H., Ruiz, C., O'Halpin, S., Wells, M. R., Hallas, B. H., Scandalis, T. A.
The Journal of the American Osteopathic Association, 2002/09
5793

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09
5794

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text
5795

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
5796

Osteopathic Manipulation Increases Active Range of Motion and Gait Parameters in Osteoarthritis: A Pilot Study
Bahamonde, L. G., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
Journal of Osteopathic Medicine, 2002/08
5797

The Effects of Cranio-Sacral CV-4 on Muscle Sympathetic Nerve Activity
Cutler, M. J., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of the American Osteopathic Association, 2002/08
5798

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08
5799

The Effects of Cranial Manipulation on Visual Function - A Pilot Study
Greenblatt, J., Sandhouse, M. E., Shechtman, D., Sorkin, R., Patterson, M., Hardigan, P., Snyder, A., Shallo-Hoffmann, J.
The Journal of the American Osteopathic Association, 2002/08
5800

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08
5801

A Randomized Controlled Trial of Osteopathic Manipulative Treatment in Chronic, Non-Specific Low Back Pain
Licciardone, J. C., Stoll, S. T., Fulda, K., Russo, D. P., Siu, J., Winn, W., Swift Jr., J.
The Journal of the American Osteopathic Association, 2002/08
5802

Effect of Osteopathic Manipulative Treatment (OMT) On Recurrent Acute Otitis Media in Children
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F., Worden, K.
The Journal of the American Osteopathic Association, 2002/08
5803

Can A Sham Treatment Blind Subjects With Obstructive Lung Disease To Group Assignment?
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08
5804

The Immediate Effect of OMT on Pulmonary Function Parameters in Obstructive Pulmonary Disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2002/08
5805

Differences in the Evaluation and Treatment of Neck and Back Pain among Osteopathic and Allopathic Family Physicians
Pedersen, B., Guillory, V. J., Lynch, J. K.
The Journal of the American Osteopathic Association, 2002/08
5806

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text
5807

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text
5808

A retrospective study of cranial strain patterns in patients with idiopathic Parkinson's disease
Rivera-Martinez, S., Wells, M. R., Capobianco, J. D.
The Journal of the American Osteopathic Association, 2002/08
Free full text
5809

Osteopathy in pregnancy and childbirth. Interview by Jenny Green
Sandler, S., Korth, S.
The Practising Midwife, 2002/07
5810

Quantifiable effects of osteopathic manipulative techniques on patients with chronic asthma
Bockenhauer, S. E., Julliard, K. N., Lo, K. S., Huang, E., Sheth, A. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
5811

Good guys and practice guidelines: osteopathic medicine's role
Harper, D. L.
The Journal of the American Osteopathic Association, 2002/07
Free full text
5812

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text
5813

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
5814

Therapeutische Ergebnisse mit der Muscle energy technique nach Mitchel beim Bandscheibenvorfall der Lendenwirbelsäule
(Results after treatment with Mitchel's muscle energy technique in disk prolapse in the lumbar spine)
Hack, A.
Manuelle Medizin, 2002/06
5815

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text
5816

A Discussion of Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
Lemley, W. W.
The AAO Journal, 2002/06
Free full text
5817

DO questions need for proposed new tenets of osteopathic medicine
Clark, R. C.
The Journal of the American Osteopathic Association, 2002/06
Free full text
5818

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text
5819

Mechanisms and effects of spinal high-velocity, low-amplitude thrust manipulation: previous theories
Evans, D. W.
Journal of Manipulative and Physiological Therapeutics, 2002/05
5820

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text
5821

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text
5822

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text
5823

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text
5824

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
5825

Effects of osteopathic manipulative treatment and concentric and eccentric maximal-effort exercise on women with multiple sclerosis: a pilot study
Yates, H. A., Vardy, T. C., Kuchera, M. L., Ripley, B. D., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
5826

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04
5827

In response
Sanders, G.
Journal of Osteopathic Medicine, 2002/04
5828

Student and patient perspectives on the interaction between supervisors, students and patients during the clinical teaching experience at a university out-patient clinic: a descriptive pilot study
Robertson, A., Gibbons, P., Carter, A.
Journal of Osteopathic Medicine, 2002/04
5829

Unity between osteopathic and allopathic medicine only answer to preserving osteopathic uniqueness
Wagner, E. E.
The Journal of the American Osteopathic Association, 2002/04
Free full text
5830

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04
5831

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03
5832

Unrelenting Abdominal Pain of Elusive Origin: A Case Study
Chapello, I. A., Templin, M. A.
The AAO Journal, 2002/03
Free full text
5833

Search Words: Osteopath, Osteopathy, Osteopathic
Chila, A. G.
The AAO Journal, 2002/03
Free full text
5834

Osteopathy: A Noun Not Just An Adjective
Habenicht, A. L.
The AAO Journal, 2002/03
Free full text
5835

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text
5836

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text
5837

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text
5838

Osteopathic philosophy must be the foundation of osteopathic medical education
Beals-Becker, L.
The Journal of the American Osteopathic Association, 2002/03
Free full text
5839

Quality of life in referred patients presenting to a specialty clinic for osteopathic manipulative treatment
Licciardone, J. C., Gamber, R. G., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/03
Free full text
5840

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text
5841

Need for objective measures to prove clinical outcome
Oleski, S. L., Kim, M. D.
The Journal of the American Osteopathic Association, 2002/03
Free full text
5842

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text
5843

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02
5844

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text
5845

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01
5846

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text
5847

An Investigation into the Efficacy of an Osteopathic/Naturopathic Treatment Regime on the Symptoms of Irritable Bowel Syndrome
Mitchell, S.
Unpublished Dissertation, 2002/01
5848

Osteopathic philosophy in comparison with other spiritual philosophical sytems
Feiel-Schmidt, G.
Unpublished MSc thesis, 2002/01
Free full text
5849

An alert regarding Canada's financial aid for an osteopathic medical education
Campbell, A.
The Journal of the American Osteopathic Association, 2002/01
Free full text
5850

End-of-life care focus critical to a complete medical education
Gaber, R.
The Journal of the American Osteopathic Association, 2002/01
Free full text
5851

Patient satisfaction and clinical outcomes associated with osteopathic manipulative treatment
Licciardone, J., Gamber, R., Cardarelli, K.
The Journal of the American Osteopathic Association, 2002/01
Free full text
5852

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text
5853

Osteopathic approach may be helpful in war on terrorism
Rogers, F. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text
5854

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text
5855

Introduction to the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center at Fort Worth
Aylett, K., Squires, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
5856

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
5857

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text
5858

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text
5859

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
5860

Pre-Doctoral Fellowship Program in the Osteopathic Manipulative Medicine Program at the Texas College of Osteopathic Medicine
Slicho, T., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
5861

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
5862

Research Accomplishments of the Department of Osteopathic Manipulative Medicine of the Texas College of Osteopathic Medicine
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
5863

Neuromusculoskeletal Medicine and Osteopathic Manipulative Treatment Residency Programs at the Osteopathic Medical Center of Texas
Stoll, S. T., Carnes, M., Brooks, L.
The AAO Journal, 2001/12
Free full text
5864

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
5865

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
5866

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
5867

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text
5868

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
5869

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text
5870

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text
5871

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text
5872

Effektivität einer osteopathischen Behandlung bei chronischem Knieschmerz
(Effectiveness of an osteopathic treatment in patients with chronic knee pain)
Bachem, U., Salzmann, S., Schwartz, I.
Unpublished D.O. thesis, 2001/10
5873

Systematische Untersuchung osteopathischer Befunde bei primärer Dysmenorrhoe
(Systematic study of osteopathic findings in primary dysmenorrhea)
Hellmann, C.
Unpublished D.O. thesis, 2001/10
5874

Hands on care
Turney, J.
Nursing Standard, 2001/10
5875

Mobilization with movement applied to the elbow affects shoulder range of movement in subjects with lateral epicondylalgia
Abbott, J. H.
Journal of Osteopathic Medicine, 2001/10
5876

The initial effects of an elbow mobilization with movement technique on grip strength in subjects with lateral epicondylalgia
Abbott, J. H., Patla, C. E., Jensen, R. H.
Journal of Osteopathic Medicine, 2001/10
5877

Short-term effects of cervical manipulation on edge light pupil cycle time: a pilot study
Gibbons, P., Gosling, C. M., Holmes, M.
Journal of Osteopathic Medicine, 2001/10
5878

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10
5879

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10
5880

Erstellen eines Methodenhandbuchs: Die Evaluation des Faktors „Kosten” bei vergleichenden Studien in der Osteopathie
(To compile of a method manual: The evaluation of the factor “cost“ in comparative studies in osteopathy.)
Schrauder, A.
Unpublished D.O. thesis, 2001/10
5881

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text
5882

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10
5883

Osteopathic treatment in rehabilitation of whiplash injury
Stockinger, V.
Unpublished MSc thesis, 2001/10
5884

Efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G.
Journal of Manipulative and Physiological Therapeutics, 2001/09
5885

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
5886

Trends in Referral Patterns by Osteopathic Physician Preceptors: Results of a Pilot Study
Iverson, G. D., Helduser, J. W., Licciardone, J. C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2001/09
5887

A Pilot Study Assessing Effects of OMT on Immune Changes Associated Wth Academic Stress
Joshi, B. P., Plotkin, B. J., Viselli, S. M.
The Journal of the American Osteopathic Association, 2001/09
5888

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text
5889

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
5890

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text
5891

Has our profession become its own worst enemy?
Fettig, L. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
5892

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09
5893

Adjunctive osteopathic manipulative treatment in women with depression: a pilot study
Plotkin, B. J., Rodos, J. J., Kappler, R., Schrage, M., Freydl, K., Hasegawa, S., Hennegan, E., Hilchie-Schmidt, C., Hines, D., Iwata, J., Mok, C., Raffaelli, D.
The Journal of the American Osteopathic Association, 2001/09
Free full text
5894

Osteopathic manipulative treatment of low back pain during labor
Carpenter, S., Woolley, A.
The AAO Journal, 2001/09
5895

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text
5896

The Evaluation of the Effect of Osteopathic Manipulative Techniques (OMT) on Headache Pain
Flotildes, K. L.
The Journal of the American Osteopathic Association, 2001/08
5897

Effect of Pre-Emptive Morphine and Postoperative Osteopathic Manipulative Technique on Pain Following Total Abdominal Hysterectomy: A Pilot Study
Goldstein, F., Jeck, S., Nicholas, A., Berman, M., Lerario, M.
The Journal of the American Osteopathic Association, 2001/08
5898

More on allopathic medical credentialing
Allee, B. A.
The Journal of the American Osteopathic Association, 2001/08
Free full text
5899

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text
5900

The Effects of a Structured OMT Curriculum on Osteopathic Exams and OMT for Hospitalized Patients
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2001/08
5901

The Effects of OMT on Vital Signs During Headache
Parikh, A. S.
The Journal of the American Osteopathic Association, 2001/08
5902

Diminished use of osteopathic manipulative treatment and its impact on the uniqueness of the osteopathic profession
Johnson, S. M., Kurtz, M. E.
Academic Medicine, 2001/08
Free full text
5903

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text
5904

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text
5905

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
5906

Characteristics, satisfaction, and perceptions of patients receiving ambulatory healthcare from osteopathic physicians: a comparative national survey
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
5907

Applications of manipulative techniques
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
5908

Osteopathic medical schools should foster sense of identity
Fogel, R. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text
5909

Beschwerden der oberen Wirbelsäule. Teil 3: Behandlungsergebnisse mit der Muscle energy Technique nach Mitchel bei Beschwerden, die von der oberen Wirbelsaule ausgehen
(Symptoms originating from the upper spine. Part 3: Results of Mitchel's Muscle Energy Technique in symptoms originating from the upper spine)
Hack, A.
Manuelle Medizin, 2001/06
5910

DOs question intent of challenge
Zorski, K. C., Woeller, K. N., Galin, C. M., Nani, S., Myers, G. P., Greenfield, J. R., Sendzicki, B., Haltof, A. H.
The Journal of the American Osteopathic Association, 2001/06
Free full text
5911

Sinusitis in children: the importance of diagnosis and treatment
Shrum, K. M., Grogg, S. E., Barton, P., Shaw, H. H., Dyer, R. R.
The Journal of the American Osteopathic Association, 2001/05
Free full text
5912

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
5913

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
5914

Letter that questions OCF requires no response
MacDonald, R. C.
The Journal of the American Osteopathic Association, 2001/05
Free full text
5915

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text
5916

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text
5917

Pain management in osteopathic medicine: The efficacy of flotation REST as an adjunct to spinal manipulation for acute non-specific low back pain. A case report
Rogan, A., Morris, T., Gibbons, P.
Journal of Osteopathic Medicine, 2001/04
5918

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
5919

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
5920

The decrease of the cranial rhythmic impulse during maximal physical exertion: an argument for the hypothesis of venomotion?
Farasyn, A., Vanderschueren, F.
Journal of Osteopathic Medicine, 2001/04
5921

The Interdisciplinary Generalist Curriculum Project at Nova Southeastern University College of Osteopathic Medicine
Blavo, C., Steinkohl, D. C.
Academic Medicine, 2001/04
Free full text
5922

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text
5923

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text
5924

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
5925

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text
5926

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text
5927

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03
5928

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text
5929

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text
5930

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text
5931

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text
5932

Snapshot Survey
General Osteopathic Council, 2001
Free full text
5933

Osteopathic medicine in the treatment of low back pain
Newswanger, D. L., Patel, A. T., Ogle, A.
American Family Physician, 2000/12
Free full text
5934

Shortness of breath and hypoxia following exploratory laparotomy
Ettlinger, H. M.
The AAO Journal, 2000/12
Free full text
5935

A practitioner survey of osteopathic manipulative treatment (OMT) techniques for specific body regions
Song, S. H.
The AAO Journal, 2000/12
Free full text
5936

Low back pain: Cost and treatment
Swords, W. J.
The AAO Journal, 2000/12
Free full text
5937

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
5938

Questioning of OCF should rouse osteopathic response
Norton, J. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text
5939

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
5940

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5941

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5942

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5943

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11
5944

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5945

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5946

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5947

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5948

Enrollment management strategies and practices at colleges of osteopathic medicine
Guidry, B. S.
Unpublished Dissertation, 2000/11
5949

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5950

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5951

Galbreath technique: a manipulative treatment for otitis media revisited
Pratt-Harrington, D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5952

Osteopathic Treatment of Idiopathic Scoliosis with Emphasis on the Fascial System
Mandl-Weber, U.
Unpublished MSc thesis, 2000/10
5953

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text
5954

Schließung und Mobilität der Synchondrosis sphenobasilaris
(Closure and mobility of the spheno-occipital synchondrosis)
Schalkhaußer, A.
Unpublished D.O. thesis, 2000/10
5955

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5956

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5957

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5958

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10
5959

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text
5960

Osteopathy and heavy metals- demonstrated by copper secretion in urine
Wutzl, C.
Unpublished MSc thesis, 2000/09
5961

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text
5962

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
5963

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
5964

How effective is the expansion of the third ventricle (E. V. III) in its influence on the neuroendocrine system?
Burjan-Lang, E.
Unpublished MSc thesis, 2000/09
5965

Effects of a structured curriculum in osteopathic manipulative treatment (OMT) on osteopathic structural examinations and use of OMT for hospitalized patients
Shubrook, J. H., Jr., Dooley
The Journal of the American Osteopathic Association, 2000/09
Free full text
5966

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09
5967

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09
5968

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08
5969

Osteopathic Manual Medicine and Acute Injuries
Coppola, G. W., Gilmore, J. L., Miars, C. W., Jacobs, A.
The Journal of the American Osteopathic Association, 2000/08
5970

Characteristics of Ambulatory Patients Visiting Osteopathic Physicians: Results from the First Osteopathic Survey of Health Care in America
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2000/08
5971

Public Perceptions of Osteopathic Physicians: Results from the First Osteopathic Survey of Health Care in America
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2000/08
5972

The First Osteopathic Survey of Health Care in America
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2000/08
5973

A Randomized Controlled Trial of Osteopathic Manipulation Following Knee or Hip Arthroplasty
Licciardone, J. C., Stoll, S. T., Herron, K. M., Gamber, R. G., Swift, J., Winn, W.
The Journal of the American Osteopathic Association, 2000/08
5974

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
5975

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08
5976

Osteopathic Manipulation in the Management of Parkinson's Disease
Wells, M. R., McCarty, C. L., Smutny, C. J., Scandalis, T. A., Dittrich, F., Fazzini, E. A.
The Journal of the American Osteopathic Association, 2000/08
5977

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
5978

Opinions Toward The Use of OMT by Oklahoma D.O.s Responding to Surveys in 1984 and 1999
Yates, H., Johnson, J. C.
The Journal of the American Osteopathic Association, 2000/08
5979

Comparison of osteopathic and allopathic results in dementia praecox. 1933
Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
5980

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text
5981

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text
5982

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text
5983

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text
5984

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06
5985

Osteopathic manipulative treatment and Down syndrome
Funk, S. L.
The AAO Journal, 2000/06
Free full text
5986

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text
5987

Osteopathic manipulative treatment in prenatal care: Evidence supporting improved outcomes and health policy implications
King, H. H.
The AAO Journal, 2000/06
Free full text
5988

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text
5989

Another great article on osteopathic manipulative treatment
Zorski, K. C.
The Journal of the American Osteopathic Association, 2000/06
Free full text
5990

Letters to the Editor
Cummings, C. H., Norton, J. M., Nelson, K. E.
The AAO Journal, 2000/06
Free full text
5991

Single-blind randomised controlled trial of chemonucleolysis and manipulation in the treatment of symptomatic lumbar disc herniation
Burton, A. K., Tillotson, K. M., Cleary, J.
European Spine Journal, 2000/06
5992

Progressive inhibition of neuromuscular structures (PINS) technique
Dowling, D. J.
The Journal of the American Osteopathic Association, 2000/05
Free full text
5993

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05
5994

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text
5995

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text
5996

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text
5997

National study of the impact of managed care on osteopathic physicians
Horan, J.
The Journal of the American Osteopathic Association, 2000/04
Free full text
5998

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04
5999

Osteopathic treatment of low back pain
Sweetman, B. J.
The New England Journal of Medicine, 2000/03
6000

Unity may preserve osteopathic ideals
Adair, A. D.
The Journal of the American Osteopathic Association, 2000/03
Free full text
6001

Relationship of preadmission variables and first- and second-year course performance to performance on the National Board of Osteopathic Medical Examiners' COMLEX-USA Level 1 examination
Baker, H. H., Cope, M. K., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2000/03
Free full text
6002

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text
6003

Brain Wave Pattern Changes in Children with ADD/ADHD following Osteopathic Manipulation: A Pilot Study
Blood, S. D., Hurwitz, B. A.
The AAO Journal, 2000/03
Free full text
6004

Case Study: OMT and Chronic Cephalgia
Brown, C. S.
The AAO Journal, 2000/03
Free full text
6005

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text
6006

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text
6007

Case Study of a 42-year-old patient with Systemic Lupus Erythematosus
Zucker, N.
The AAO Journal, 2000/03
Free full text
6008

Refractory torticollis after a fall
Kaprow, M. G., Sandhouse, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
6009

Multiple sclerosis article ignores conventional and osteopathic treatment options
Schreier, E. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
6010

Research on OPP/OMT is Critical to the Profession's Future
Noone, S. J.
The AAO Journal, 2000/03
Free full text
6011

Letters to the Editor
Friedman, H. D., McMillin, D. L., Richards, D. G., Mein, E. A., Nelson, C. D., Kellam, R. T., Patriquin, D. A., Clark, R. C.
The AAO Journal, 2000/03
Free full text
6012

Letters to the Editor
Orlando, C., Field, L.
The New England Journal of Medicine, 2000/03
6013

Osteopathic treatment of low back pain
Cherkin, D.
The New England Journal of Medicine, 2000/03
6014

Osteopathic treatment of low back pain
Foster, D., Johnson, M. D., Harrelson, A.
The New England Journal of Medicine, 2000/03
6015

Osteopathic treatment of low back pain
Oppenheim, J. S.
The New England Journal of Medicine, 2000/03
6016

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
6017

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02
6018

Inter-examiner and intra-examiner agreement for assessing sacroiliac anatomical landmarks using palpation and observation: pilot study
O'Haire, C., Gibbons, P.
Manual Therapy, 2000/02
6019

Importance of empiricism in medicine
Hartman, S. E.
The Journal of the American Osteopathic Association, 2000/02
Free full text
6020

Paradox answered
Parker, C.
The Journal of the American Osteopathic Association, 2000/02
Free full text
6021

Physician recalls unforgettable evening in her early career
Wales, A. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
6022

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
6023

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01
6024

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text
6025

Craniosacral therapy in pediatric occupational therapy
Herman-Rosen, S. A., Kohn-Dembitzer, R.
Unpublished MSc thesis, 2000/01
6026

A systematic review of craniosacral therapy: Biological plausibility, assessment reliability and clinical effectiveness
Green, C., Martin, C. W., Bassett, K., Kazanjian, A.
Complementary Therapies in Medicine, 1999/12/01/
6027

OMT and diffuse musculoskeletal complaints following a motor vehicle accident
Bezilla, T. A.
The AAO Journal, 1999/12
Free full text
6028

Take the time to teach to ensure the legacy and future of our profession
Steier, K. J.
Journal of Osteopathic Medicine, 1999/12
Free full text
6029

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12
6030

Osteopathic treatment of asthma: A literature review and call for research
Jackson, K. M., Steele, K. M.
The AAO Journal, 1999/12
Free full text
6031

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text
6032

Evaluierung und kritische Bewertung von in der europaischen Literatur veroffentlichten, osteopathischen Studien im klinischen Bereich und im Bereich der Grundlagenforschung.
(Evaluation and critical review published in the European literature on osteopathic studies in the clinical field and in the area of fundamental research)
Schwerla, F., Hass-Degg, K., Schwerla, B.
Forschende Komplementärmedizin, 1999/12
6033

Assessing the impact of complementary therapy on health status: a service evaluation of the benefits of acupuncture, homoeopathy and osteopathy using the SF-36 health survey and a waiting list control group
Richardson, J.
Unpublished PhD thesis, 1999/12
Free full text
6034

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11
6035

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text
6036

A comparison of osteopathic spinal manipulation with standard care for patients with low back pain
Andersson, G. B., Lucente, T., Davis, A. M., Kappler, R. E., Lipton, J. A., Leurgans, S.
The New England Journal of Medicine, 1999/11
Free full text
6037

New hypothesis for the origin of cranio-sacral motion
Farasyn, A.
Journal of Bodywork and Movement Therapies, 1999/10/01/
6038

ABC of complementary medicine. The manipulative therapies: osteopathy and chiropractic
Vickers, A., Zollman, C.
The BMJ, 1999/10
6039

Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
(Inter rater reliability of the Downing test regarding leg length discrepancy)
Hösele, K.
Unpublished D.O. thesis, 1999/10
6040

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text
6041

Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
(Intracranial membrane tension release of children with hyperactive disorder)
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
6042

(Inter rater reliability of the Downing test regarding leg length discrepancy)
Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
Hösele, K.
Unpublished D.O. thesis, 1999/10
6043

(Intracranial membrane tension release of children with hyperactive disorder)
Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
6044

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10
6045

Low back pain in pregnancy
Gallagher, K. M.
The AAO Journal, 1999/09
Free full text
6046

A review of the principles of William G. Sutherland's general techniques
Golden, W. J.
The AAO Journal, 1999/09
Free full text
6047

DOs need more training in diagnosing and treating addiction
Goldstein, F. J.
Journal of Osteopathic Medicine, 1999/09
Free full text
6048

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text
6049

Perspectives: An overview of support for osteopathy in the cranial field
Kuchera, M. L.
The AAO Journal, 1999/09
Free full text
6050

Meniere's syndromes resulting from multiple traumatic brain injury: Two case studies
Lockhart, W. C.
The AAO Journal, 1999/09
Free full text
6051

Osteopathic manipulative treatment of an 8-year-old child born with anoxia
Morelli, M. A.
The AAO Journal, 1999/09
Free full text
6052

Osteopathic medical education in the 21st century--translating educational challenges into professional opportunities
Kasovac, M.
Journal of Osteopathic Medicine, 1999/08
Free full text
6053

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text
6054

Remember the DO difference
Rossi, P. C.
Journal of Osteopathic Medicine, 1999/07
Free full text
6055

Training osteopathic geriatric academicians: impact of a model geriatric residency program
Cavalieri, T. A., Basehore, P., Perweiler, E., Chopra, A.
Journal of Osteopathic Medicine, 1999/07
Free full text
6056

OMT and urinary incontinence
Farley, J. E.
The AAO Journal, 1999/06
Free full text
6057

MRI assessment of changes in swelling of wrist structures following OMT in patients with carpal tunnel syndrome
Ramey, K. A., Kappler, R. E., Chimata, M., Hohner, J., Mizera, A. C.
The AAO Journal, 1999/06
Free full text
6058

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text
6059

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text
6060

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text
6061

DO's approach to patient is 'wholistic'--not holistic
Gotfried, R.
Journal of Osteopathic Medicine, 1999/05
Free full text
6062

The Effectiveness of CV-4 and Resting Position Techniques on Subjects with Tension-Type Headaches
Hanten, William P., Olson, Sharon L., Hodson, Jennifer L., Imler, Vickie L., Knab, Virginia M., Magee, Jennifer L.
Journal of Manual & Manipulative Therapy, 1999/04/01
6063

Support programs for minority students at Ohio University College of Osteopathic Medicine
Thompson, H. C., Weiser, M. A.
Academic Medicine, 1999/04
6064

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text
6065

Call to develop and implement dually approved residency programs
Daftarian, H.
Journal of Osteopathic Medicine, 1999/04
Free full text
6066

Dancing Elaine neck syndrome
Chin, C.
The AAO Journal, 1999/03
Free full text
6067

1998 Louisa Burns Memorial Lecture: can teaching and research coexist?
Yorio, T.
Journal of Osteopathic Medicine, 1999/03
Free full text
6068

Adjunctive osteopathic manipulative treatment in the elderly hospitalized with pneumonia: a pilot study
Noll, D. R., Shores, J., Bryman, P. N., Masterson, E. V.
Journal of Osteopathic Medicine, 1999/03
Free full text
6069

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text
6070

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text
6071

Seize opportunity to foster osteopathic pride
Bahrami, P.
Journal of Osteopathic Medicine, 1999/03
Free full text
6072

The Use of OMT in Stroke Rehabilitation
Maxwell, S.
The AAO Journal, 1999/03
Free full text
6073

The principles of osteopathic structural therapy – Part IV
Page, L. E.
The AAO Journal, 1999/03
Free full text
6074

A model for teaching and assessing high velocity low amplitude thrust techniques
Wells, K.
The AAO Journal, 1999/03
Free full text
6075

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text
6076

Time to tell the world about osteopathic medicine
Oliveri, E. A., Osborn, G. C.
Journal of Osteopathic Medicine, 1999/02
Free full text
6077

Revisiting the role of osteopathic manipulation in primary care
Hopp, R. J.
Journal of Osteopathic Medicine, 1999/02
Free full text
6078

An international study of osteopathic practice
Cameron, M.
Unpublished MSc thesis, 1999/01
Free full text
6079

Comparison of the scope of allopathic and osteopathic medical school health promotion programs for students
Hooper, J., Cox, C. C., Cambre, K., Wilburn, D., Webster, M., Wolf, T.
American Journal of Health Promotion, 1999/01
6080

Widespread confusion prevails over 'osteopathy'
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/12
Free full text
6081

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament
Sucher, B. M., Hinrichs, R. N.
Journal of Osteopathic Medicine, 1998/12
Free full text
6082

The evolution of professional identity: the case of osteopathic medicine
Miller, K.
Social Science & Medicine, 1998/12
6083

The principles of osteopathic structural therapy – Part III
Page, L. E.
The AAO Journal, 1998/12
Free full text
6084

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text
6085

Case Study: OMT and the enlarged prostate
Smutney, C. J.
The AAO Journal, 1998/12
Free full text
6086

Scoliosis and Osteopathic Manipulative Treatment
Weatherly, J.
The AAO Journal, 1998/12
Free full text
6087

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text
6088

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
6089

Dual approval of a residency program: ten years' experience and implications for postdoctoral training
Hayes, O. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
6090

Comparison of personality styles between students enrolled in osteopathic medical, pharmacy, physical therapy, physician assistant, and occupational therapy programs
Hardigan, P. C., Cohen, S. R.
Journal of Osteopathic Medicine, 1998/11
Free full text
6091

Simultaneous palpation of the craniosacral rate at the head and feet: intrarater and interrater reliability and rate comparisons
Rogers, J. S., Witt, P. L., Gross, M. T., Hacke, J. D., Genova, P. A.
Physical Therapy, 1998/11
6092

Evaluierung und kritische Bewertung von Studien der Osteopathie im klinischen Bereich und im Bereich der Grundlagenforschung in der europäischen Literatur
(Evaluation and Critical Review of Clinical and Fundamental Research Studies on Osteopathy Published in the European Literature)
Schwerla, B., Hass-Degg, F., Schwerla, F.
Unpublished D.O. thesis, 1998/10
6093

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text
6094

Die osteopathische Behandlung für Kinder mit Down-Syndrom mit Schwerpunkt auf dem Os Occipitale
(The osteopathic treatment for children with Down syndrome with emphasis on the Os Occipitale)
Kasack, A.
Unpublished D.O. thesis, 1998/10
6095

Sinusitus Supplement missing osteopathic component
Dudley, G.
Journal of Osteopathic Medicine, 1998/10
6096

Short leg syndrome
Lal, S.
The AAO Journal, 1998/09
Free full text
6097

Correction to 'professional identity' article
Tettambel, M. A.
Journal of Osteopathic Medicine, 1998/09
Free full text
6098

Key to our survival lies in honesty
Olson, C. D.
Journal of Osteopathic Medicine, 1998/09
Free full text
6099

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09
6100

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09
6101

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09
6102

The principles of osteopathic structural therapy – Part II
Page, L. E.
The AAO Journal, 1998/09
Free full text
6103

Case study: Neck and shoulder pain
Pasquarello, G.
The AAO Journal, 1998/09
Free full text
6104

Alternative therapies and complementary medicine: a mutiny in the making
Friedman, H. D.
Journal of Osteopathic Medicine, 1998/09
Free full text
6105

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text
6106

Dysfunction of the 'sacred' sacrum – Techniques for treating individual pole restrictions
Wells, K.
The AAO Journal, 1998/09
Free full text
6107

An 'apples-to-apples' comparison of training hours for DOs, PAs, NPs
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/08
Free full text
6108

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text
6109

Study of attitudes and beliefs about obesity on second and third year osteopathic medical students
Bradley, C. A.
Unpublished MSc thesis, 1998/08
Free full text
6110

Environmental factors promoting the effective use of a computer-assisted clinical case for second-year osteopathic medical students
Baer, R. W., Chamberlain, N. R.
Journal of Osteopathic Medicine, 1998/07
Free full text
6111

A pilot study: Osteopathic treatment of infants with a sucking dysfunction
Fraval, M.
The AAO Journal, 1998/06
Free full text
6112

Solar Plexus Injuries: An old injury with a new twist
Jones, J. M., May, T.
The AAO Journal, 1998/06
Free full text
6113

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06
6114

The principles of osteopathic structural therapy – Part I
Page, L. E.
The AAO Journal, 1998/06
Free full text
6115

Role of the DOs in the 'Spanish Flu' Pandemic of 1918-1920
Richardson, M. E.
The AAO Journal, 1998/06
Free full text
6116

Case History
Strait, B. W.
The AAO Journal, 1998/06
Free full text
6117

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05
6118

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05
6119

Are D.O.s losing their unique identity?
Guglielmo, W. J.
Medical Economics, 1998/04
6120

Coming full circle: osteopathic manipulative treatment and immunity
Allen, T. W.
Journal of Osteopathic Medicine, 1998/04
6121

Application of osteopathic principles to a viral upper respiratory infection
Cavanaugh, S. P.
The AAO Journal, 1998/03
Free full text
6122

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03
6123

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03
6124

Psychosynergisis®, a synthesis of cranial osteopathy, acupuncture, and homeopathic medicine in psychiatry
Pribadi, K. S.
The AAO Journal, 1998/03
Free full text
6125

Communication for osteopathic manipulative treatment (OMT): the language of lived experience in OMT pedagogy
Gaines, E., Chila, A. G.
Journal of Osteopathic Medicine, 1998/03
6126

Sinusitis and OMT
Sept, K.
The AAO Journal, 1998/03
Free full text
6127

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02
6128

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02
6129

Re-examining the number of osteopathic residency programs
Baker, H. H.
Journal of Osteopathic Medicine, 1998/02
6130

Osteopathic versus allopathic care
Wakham, M.
Hospital Practice, 1998/01
6131

A compilation of the thoughts of George W. Northup, DO, on the philosophy of osteopathic medicine
Peterson, B.
Journal of Osteopathic Medicine, 1998/01
6132

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01
6133

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01
6134

Inpatient osteopathic manipulative treatment: Impact on length of stay
Cantieri, M. S.
The AAO Journal, 1997/12
Free full text
6135

Motor-vehicle accident trauma
File, P. M.
The AAO Journal, 1997/12
Free full text
6136

The basic principles of osteopathic practice
Hollis, A. S.
The AAO Journal, 1997/12
Free full text
6137

Pain: a functional disorder
Ernst, E.
British Journal of General Practice, 1997/12
Free full text
6138

Leading the pace of change: crisis or opportunity?
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/12
Free full text
6139

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text
6140

Anatomy of an OPTI dissected: structure, function, and the impact of budget reconciliation legislation
Opipari, M. I.
Journal of Osteopathic Medicine, 1997/11
Free full text
6141

A snapshot of osteopathic medical education in 1997
Retz, K. C.
Journal of Osteopathic Medicine, 1997/11
Free full text
6142

Forecast for osteopathic medical education programs in the for-profit hospital environs
Spink, G. C.
Journal of Osteopathic Medicine, 1997/11
Free full text
6143

(Osteopathy treatment)
Osteopathie-Behandlung
Mach, J.
Deutsche Medizinische Wochenschrift, 1997/10
6144

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text
6145

The effects of muscle energy technique on lumbar range of motion
Schenk, R. J., MacDiarmid, A., Rousselle, J.
Journal of Manual and Manipulative Therapy, 1997/10
6146

Managing back pain in general practice--is osteopathy the new paradigm?
Williams, N.
British Journal of General Practice, 1997/10
Free full text
6147

Using heart variability to measure the effects of manual medicine on autonomic activity
Zullow, M.
Unpublished MSc thesis, 1997/10
6148

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text
6149

Case history: Low back pain with a radiating 'electric shock'
McCarty, C. L.
The AAO Journal, 1997/09
Free full text
6150

The effect of osteopathic manipulative treatment (OMT) on heart rate and blood pressure in female athletes
Paul, F. A., Norton, J. M., Cross, N. A., Buser, B. R.
The AAO Journal, 1997/09
Free full text
6151

Pondering the effects of the Reconciliation Budget law on osteopathic medical education
Wood, D. L.
Journal of Osteopathic Medicine, 1997/09
Free full text
6152

Osteopathic manipulative treatment of Bell's palsy
Ulrich, R. F
The AAO Journal, 1997/09
Free full text
6153

The art of osteopathy
Wales, A. L.
The AAO Journal, 1997/09
Free full text
6154

The controversy of cranial bone motion
Rogers, J. S., Witt, P. L.
Journal of Orthopaedic & Sports Physical Therapy, 1997/08
6155

An osteopathic prescription for medical education reform: Part 2. Specialty mix and community integration
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/08
Free full text
6156

An osteopathic prescription for medical education reform: Part 1. Curriculum and infrastructure
Ross-Lee, B., Wood, D. L., Mann, D. D., Portanova, R. P., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/07
Free full text
6157

Comparison of performance on the American Osteopathic Board of Internal Medicine certifying examination 1986 to 1996 by type of residency
Slick, G. L.
Journal of Osteopathic Medicine, 1997/07
Free full text
6158

The hysteresis loop as a model for low back motion analysis
Warner, M. J., Mertz, J. A., Zimmerman, A. S.
Journal of Osteopathic Medicine, 1997/07
Free full text
6159

A successful use of cranial-sacral osteopathy in the treatment of post-traumatic headache following subarachnoid hemorrhage
Barke, L., Gelman, S., Lipton, J. A.
The AAO Journal, 1997/06
Free full text
6160

OMM and Asthma
Jealous, J. S.
The AAO Journal, 1997/06
Free full text
6161

Informing public, students will make profession 'visible'
Bahrami, P.
Journal of Osteopathic Medicine, 1997/06
Free full text
6162

Osteopathic manifesto. VI. The light of the profession. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/06
Free full text
6163

Efficacy of osteopathic manipulative treatment in improving clinical outcomes in patients with orthopedic diagnoses admitted to a hospital-based rehabilitation unit
Brittain, P. D.
Unpublished MSc thesis, 1997/06
6164

Cervical spine manipulation: summary report of a systematic review of the literature and a multidisciplinary expert panel
Shekelle, P. G., Coulter, I.
Journal of Spinal Disorders, 1997/06
6165

Comparing medical knowledge of osteopathic medical trainees in DO and MD programs: a random effect meta-analysis
Shen, L., Cavalieri, T., Clearfield, M., Smoley, J.
Journal of Osteopathic Medicine, 1997/06
Free full text
6166

Introducing the cranial approach in osteopathy and the treatment of infants and mothers
Sullivan, C.
Complementary Therapies in Nursing and Midwifery, 1997/06
6167

Chest pain and the role of somatic dysfunction
Wax, C. M., Abend, D. S., Pearson, P. H.
Journal of Osteopathic Medicine, 1997/06
Free full text
6168

Muscle tones
Waldron, B. J.
The AAO Journal, 1997/06
Free full text
6169

From 'Osteopathic Manipulative Procedure in Disorders of the Eye'
Wolf, A. H.
The AAO Journal, 1997/06
Free full text
6170

Will failure to use OMT be grounds for malpractice?
Allen, T. W.
Journal of Osteopathic Medicine, 1997/05
Free full text
6171

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text
6172

Osteopathic medical considerations of reflex sympathetic dystrophy
Nelson, K. E.
Journal of Osteopathic Medicine, 1997/05
Free full text
6173

Osteopathic manipulation for low back pain
Abend, D. S.
Postgraduate Medicine, 1997/04
6174

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text
6175

Soft tissue manipulation: neuromuscular and muscle energy techniques
Roberts, B. L.
Journal of Neuroscience Nursing, 1997/04
6176

Case History: Intractable Low Back Pain
Koss, R. M.
The AAO Journal, 1997/03
Free full text
6177

Carpal Tunnel Syndrome
Miller, K.
The AAO Journal, 1997/03
Free full text
6178

Osteopathic Medical Profession: Who are we & Where are we going? A student perspective
Nemon, B. M.
The AAO Journal, 1997/03
Free full text
6179

Comparison of entrance requirements for health care professions
Doxey, T. T., Phillips, R. B.
Journal of Manipulative and Physiological Therapeutics, 1997/02
6180

Can DOs still 'circle the wagons'? Reflections on the use of osteopathic manipulative treatment
Fry, L. J.
Journal of Osteopathic Medicine, 1997/02
Free full text
6181

Variables influencing the use of osteopathic manipulative treatment in family practice
Johnson, S. M., Kurtz, M. E., Kurtz, J. C.
Journal of Osteopathic Medicine, 1997/02
Free full text
6182

Osteopathic manipulative treatment: student attitudes before and after intensive clinical exposure
Magnus, W. W., Gamber, R. G.
Journal of Osteopathic Medicine, 1997/02
Free full text
6183

Osteopathic physicians and expert medical testimony
McAbee, G. N.
Journal of Osteopathic Medicine, 1997/01
Free full text
6184

The utilization of craniosacral therapy among healthcare practitioners and its awareness among occupational therapists
Avallone, S., Belli, D.
Unpublished MSc thesis, 1997/01
6185

Pilot study to establish whether osteopathy reduces general practice consultation rate of musculoskeletal problems based on patient perception of effectiveness of the osteopathic treatment – Part II
Banihasem, M.
The AAO Journal, 1996/12
Free full text
6186

A challenge to the concept of craniosacral interaction
Norton, J. M.
The AAO Journal, 1996/12
Free full text
6187

From Principles of Osteopathy
Page, L. E.
The AAO Journal, 1996/12
Free full text
6188

AAO Case History: Iatrogenic injury to the cranial mechanism
Skurla, R. W.
The AAO Journal, 1996/12
Free full text
6189

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6190

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6191

Geriatric education in osteopathic medical schools
Carlsen, W., Pfeiffer, B., Marx, T., Bonyo, B.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6192

Osteopathic medical education at the bridge to the 21st century
Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6193

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6194

In pursuit of generalism: basic factors influencing the specialty decisions of osteopathic medical school seniors in 1995
Singer, A. M.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6195

Research programs of the AOA and their role in osteopathic medical education
Retz, K. C., McGill, S. L.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6196

Income and expenditures of osteopathic medical colleges
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6197

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text
6198

Obtaining credentials for osteopathic manipulative medicine
Kuchera, M. L.
American Family Physician, 1996/10
6199

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text
6200

A manipulative technique of Andrew Taylor Still as reported by Charles Hazzard, DO, in 1905
Van Buskirk, R. L.
The Journal of the American Osteopathic Association, 1996/10
Free full text
6201

Pilot study to establish whether osteopathy reduces general practice consultation rate of musculoskeletal problems based on patient perception of effectiveness of the osteopathic treatment – Part I
Banihasem, M.
The AAO Journal, 1996/09
Free full text
6202

The efficacy of osteopathic treatment for primary dysmenorrhea in young women
Chadwick, K., Morgan, A.
The AAO Journal, 1996/09
Free full text
6203

Standardization of the hospital record for osteopathic structural examination: Part 2. Effects of an educational intervention on documentation of palpatory and structural findings and diagnosis
Friedman, H. D., Johnston, W. L., Kelso, A. F., Schwartz, F. N., Beal, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 1996/09
Free full text
6204

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09
6205

AAO Case History: Common problems in newborn and infant
Sholars, H.
The AAO Journal, 1996/09
Free full text
6206

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text
6207

Craniosacral therapy
Elsdale, B.
Nursing Times, 1996/07
6208

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text
6209

AAO Case Study: Recurrent Otitis Media
Gintis, B. R.
The AAO Journal, 1996/06
Free full text
6210

The Effects of Somatic Dysfunction on the Spinal Accessory Nerve (CN XI) with Subsequent Distal Dysfunction
Gorbis, S.
The AAO Journal, 1996/06
Free full text
6211

An Osteopathic Approach to HIV/AIDS
Mulligan, T.
The AAO Journal, 1996/06
Free full text
6212

(Diagnosis and therapy for reversible hypomobile dysfunction in the chest wall)
Neumann, H.D.
Manuelle Medizin, 1996/04
6213

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text
6214

The osteopathic physician teacher
Grimshaw, D. N.
The AAO Journal, 1996/03
Free full text
6215

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text
6216

Case History: Somatic dysfunctions related to chronic lumbar and hip strain
Jones, J. M.
The AAO Journal, 1996/03
Free full text
6217

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text
6218

Osteopathy and medical evolution (1962)
Korr, I. M.
The AAO Journal, 1996/03
Free full text
6219

Sacral shear: Review and a new treatment for obstetrical patients
Treadwell, R. C., Magnus, W. W.
The AAO Journal, 1996/03
Free full text
6220

Update on osteopathic medical concepts and the lymphatic system
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 1996/02
Free full text
6221

Preliminary findings on the use of osteopathic manipulative treatment by osteopathic physicians
Fry, L. J.
The Journal of the American Osteopathic Association, 1996/02
Free full text
6222

When it comes to OMT, do we practice what we preach?
Kasovac, M.
The Journal of the American Osteopathic Association, 1996/02
Free full text
6223

The safety of manipulative treatment: review of the literature from 1925 to 1993
Vick, D. A., McKay, C., Zengerle, C. R.
The Journal of the American Osteopathic Association, 1996/02
Free full text
6224

Marketing key to increased women applicants to COMs
Payson, S. M.
The Journal of the American Osteopathic Association, 1996/01
Free full text
6225

(Manual therapy, chiropractic, osteopathy. From alternative therapy to medicine)
Ylinen, J., Piispanen, J., Silen, K., Airaksinen, O.
Duodecim, 1996/01
6226

AAO Case Study: Trigeminal Neuralgia
Coffey, D.
The AAO Journal, 1995/12
Free full text
6227

Manipulation of the Eustachian Tube
Heatherington, J. S.
The AAO Journal, 1995/12
Free full text
6228

Osteopathic GME consortia
Meyer, C. T., Mann, M. P.
Academic Medicine, 1995/11
6229

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text
6230

Synergism strengthens osteopathic medical education programs
Allen, T. W.
Journal of Osteopathic Medicine, 1995/10
Free full text
6231

Female enrollment in colleges of osteopathic medicine: five years and five percentage points behind
Baker, H. H.
The Journal of the American Osteopathic Association, 1995/10
Free full text
6232

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text
6233

Osteopathic graduate medical education programs must be maintained
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/09
Free full text
6234

Hospital guidelines for diagnosis-related groups/osteopathic manipulative treatment
Feely, R. A.
The Journal of the American Osteopathic Association, 1995/09
Free full text
6235

Proposed matrix could yield bountiful 'harvest'
Stiles, E. G.
The Journal of the American Osteopathic Association, 1995/09
Free full text
6236

The Effect of Osteopathic Manipulative Treatment in the Post Abdominal Surgical Patient (A Preliminary Study)
Pratt-Harrington, D., Neptune-Ceran, R.
The AAO Journal, 1995/09
Free full text
6237

AAO Case Study: Demonstration of the Fundamental Tenent of Osteopathy
Stanley, S. A.
The AAO Journal, 1995/09
Free full text
6238

Phenobarbital-induced fibromyalgia as the cause of bilateral shoulder pain
Goldman, S. I., Krings, M. S.
The Journal of the American Osteopathic Association, 1995/08
Free full text
6239

Palpatory diagnosis and manipulative management of carpal tunnel syndrome: Part 2. 'Double crush' and thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1995/08
Free full text
6240

10,000 apply to osteopathic schools
Japsen, B.
Modern Healthcare, 1995/06
6241

Osteopathic graduate medical education: don't give up the ship--yet!
Meyer, C. T.
Journal of Osteopathic Medicine, 1995/06
Free full text
6242

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text
6243

Performance of osteopathic medical school graduates on the American Osteopathic Board of Internal Medicine certifying examinations 1985 to 1994
Slick, G. L., Dolan, S., Draba, R. E.
The Journal of the American Osteopathic Association, 1995/06
Free full text
6244

AAO Case Study: Severe Left Hip Pain
Tenpenny, S. J.
The AAO Journal, 1995/06
Free full text
6245

The Experimental Method of Learning
Young, M. D.
The AAO Journal, 1995/06
6246

Nerve compression syndromes as models for research on osteopathic manipulative treatment
Luckenbill-Edds, L., Bechill, G. B.
The Journal of the American Osteopathic Association, 1995/05
Free full text
6247

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text
6248

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text
6249

Asthma Treated by Visceral Manipulation
Bensky, D.
The AAO Journal, 1995/03
Free full text
6250

AAO Case Study: Chronic Upper Extremity Pain
DeFeo, G. A.
The AAO Journal, 1995/03
Free full text
6251

Time to abolish most osteopathic graduate medical education programs
Kienitz, R.
The Journal of the American Osteopathic Association, 1995/03
Free full text
6252

Postnatal back care
Parsons, C.
The Modern Midwife, 1995/02
6253

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text
6254

Performances of candidates with osteopathic compared with allopathic subspecialty training on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984 to 1992
Slick, G. L., Dolan, S.
The Journal of the American Osteopathic Association, 1994/12
Free full text
6255

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text
6256

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text
6257

AAO Case History: Immune System
Wallace, E. M.
The AAO Journal, 1994/12
Free full text
6258

Letter to the Editor
McPartland, J. M.
The AAO Journal, 1994/12
Free full text
6259

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text
6260

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text
6261

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text
6262

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text
6263

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text
6264

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text
6265

Gender effects on student performances on the NBOME Part I, Part II, and Part III
Shen, L.
Academic Medicine, 1994/10
Free full text
6266

Perception of Osteopathic Women Physician Leaders: Current Status and Future Directions
Chapello, I. A.
The AAO Journal, 1994/09
Free full text
6267

Management of the Cervical Area
Denslow, J. S.
The AAO Journal, 1994/09
Free full text
6268

Entry of US medical school graduates into family practice residences: 1993-1994 and 3-year summary
Kahn, N. B., Jr., Schmittling, G., Graham
Family Medicine, 1994/09
6269

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09
6270

AAO Case Study: Sinusitis
Sept, K.
The AAO Journal, 1994/09
Free full text
6271

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text
6272

Palpatory diagnosis and manipulative management of carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 1994/08
Free full text
6273

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text
6274

The outlook for osteopathic medical specialists within a reformed healthcare system
Ross-Lee, B., Weiser, M. A., Kiss, L.
The Journal of the American Osteopathic Association, 1994/07
Free full text
6275

Osteopathic manipulation and injection therapy for low back pain
Orman, R.
American Family Physician, 1994/07
6276

The in-training examination in internal medicine
Garibaldi, R. A., Trontell, M. C., Waxman, H., Holbrook, J. H., Kanya, D. T., Khoshbin, S., Thompson, J., Casey, M., Subhiyah, R. G., Davidoff, F.
Annals of Internal Medicine, 1994/07
6277

Cranio-sacral therapy and the treatment of common childhood conditions
Attlee, T.
Health Visitor, 1994/07
6278

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text
6279

Complexity of the healthcare crisis in rural America
Simpson, C., Simpson, M. A.
The Journal of the American Osteopathic Association, 1994/06
Free full text
6280

A Tensegrity Model for Osteopathy in the Cranial Field
Cummings, C. H.
The AAO Journal, 1994/06
Free full text
6281

AAO Case History: Postpartum Facial Palsy
Lee, R. P.
The AAO Journal, 1994/06
Free full text
6282

You can be both conventional and nonconventional
Abend, D. S.
Archives of Family Medicine, 1994/06
6283

Stranger in a New Land
Mills, M.
The AAO Journal, 1994/06
Free full text
6284

Osteopathic principles underlie treatment of back pain
Moncman, M.G.
The Journal of the American Osteopathic Association, 1994/06
Free full text
6285

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text
6286

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text
6287

DOs encouraged to participate in pharmaceutical, clinical trials
Allen, T. W.
The Journal of the American Osteopathic Association, 1994/05
Free full text
6288

More suggested changes to osteopathic medical curriculum
Clark, R. C.
The Journal of the American Osteopathic Association, 1994/05
Free full text
6289

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text
6290

Dark period in history of osteopathic medicine revisited
Frymann, V. M.
The Journal of the American Osteopathic Association, 1994/04
Free full text
6291

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text
6292

Performance of candidates on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984-1992
Slick, G. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text
6293

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text
6294

Manual Medicine and its Role in Psychiatry
Osborn, G. G.
The AAO Journal, 1994/03
Free full text
6295

Outcome Data for Patients Experiencing Chronic Pain
Stiles, E. G.
The AAO Journal, 1994/03
Free full text
6296

Osteopathy – How It Differs from Other Manual Methods
Woodall, P. H.
The AAO Journal, 1994/03
Free full text
6297

Effects of adding sacral base leveling to osteopathic manipulative treatment of back pain: a pilot study
Hoffman, K. S., Hoffman, L. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text
6298

Revamp primary care programs to include psychiatry training
Magen, J. G.
The Journal of the American Osteopathic Association, 1994/03
Free full text
6299

Managed care: an opportunity for osteopathic physicians
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/02
Free full text
6300

Effects of osteopathic manipulative treatment in patients with cervicothoracic pain: pilot study using thermography
Walko, E. J., Janouschek, C.
The Journal of the American Osteopathic Association, 1994/02
Free full text
6301

Clarifying number of DOs in allopathic residency programs
Sprafka, S.
The Journal of the American Osteopathic Association, 1994/01
Free full text
6302

Osteopathic manipulative treatment: what does it really do?
Steiner, C.
The Journal of the American Osteopathic Association, 1994/01
Free full text
6303

A strategy for the future success of osteopathic medicine
Wax, C. M.
The Journal of the American Osteopathic Association, 1994/01
Free full text
6304

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text
6305

Osteopathic manipulation for lumbar disk disease
Pearson, R. H.
American Family Physician, 1994/01
6306

Readers respond to 'osteopathic physician' identity
Rentz, L. E., Goldstein, M.
The Journal of the American Osteopathic Association, 1994/01
Free full text
6307

Debate continues on the call to reform the profession
Terry, R. R., Comeaux, Z., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text
6308

The osteopathic distinction: fact or fancy?
Peppin, J. F.
The Journal of Medical Humanities, 1993/12
6309

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text
6310

Response: Debate continues on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/12
Free full text
6311

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text
6312

Osteopathic manipulation and tension-type headaches
Baird, R. E., Cullom, S., Deedman, R., Feeney, J., Kellogg, J., Simning, P., Stevens, M. B.
American Family Physician, 1993/11
6313

No 'paradigm shift' needed at COMs
Richwine, W. B., Papa, F. J.
The Journal of the American Osteopathic Association, 1993/11
Free full text
6314

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text
6315

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text
6316

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text
6317

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text
6318

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text
6319

Lifestyle changes associated with osteopathic medical education
Crapse, F. J., Jr., Hudgins, P. M., Baker
The Journal of the American Osteopathic Association, 1993/10
Free full text
6320

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text
6321

More comments on the call to reform the profession
McPartland, J. M., Pulsipher, D. W., Cope, M. K., Wagenknecht, D. A.
The Journal of the American Osteopathic Association, 1993/10
Free full text
6322

Response: More comments on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/10
Free full text
6323

Primary care DOs, specialists--and OMM--important to profession
Wax, C. M.
The Journal of the American Osteopathic Association, 1993/09
Free full text
6324

AAO Case History
Somner, L.
The AAO Journal, 1993/09
Free full text
6325

'Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/09
Free full text
6326

Entry of US medical school graduates into family practice residencies: 1992-1993 and three-year summary
Kahn, N. B., Jr., Graham, R., Schmittling
Family Medicine, 1993/09
6327

Osteopathy vs chiropractic
Friedman, H.
The Journal of Family Practice, 1993/09
Free full text
6328

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text
6329

OMT enhances any medical regimen
Keller, J. A.
The Journal of the American Osteopathic Association, 1993/09
Free full text
6330

(Trends in therapy by “manipulation“, basic concepts of manual therapy)
A “müfogásokkal“ gyógyítás irányzatai, a manuális terápia alapfogalmai
Ormos, G.
Orvosi Hetilap, 1993/08
6331

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text
6332

Readers offer suggestions for reforms in osteopathic medicine
Rosenblum, J.
The Journal of the American Osteopathic Association, 1993/08
Free full text
6333

Predictors of Academic Difficulties of Osteopathic Medical Students in the Preclinical Curriculum
Cigelman, M. S.
Unpublished Dissertation, 1993/08
Free full text
6334

Another view of the “crisis“ in osteopathic medicine
Baker, H. H.
Academic Medicine, 1993/07
Free full text
6335

Complementary medicine. Who prescribes these treatments and when?
Ernst, E.
British Medical Journal, 1993/07
Free full text
6336

Helping-not hurting--residents with substance use disorders
Sells, K. W., Gorby, W. G.
The Journal of the American Osteopathic Association, 1993/06
Free full text
6337

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text
6338

Investigating the role of osteopathic manipulation in the treatment of asthma
Allen, T. W., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 1993/06
Free full text
6339

Research secures the future of osteopathic medicine: Part 2: Readdressing the function and structure of colleges of osteopathic medicine
Papa, F. J.
The Journal of the American Osteopathic Association, 1993/06
Free full text
6340

Research secures the future of osteopathic medicine: Part 1. Research--foundation for faculty development, institutional recognition
Papa, F. J.
The Journal of the American Osteopathic Association, 1993/05
Free full text
6341

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text
6342

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text
6343

Osteopathy, chiropractic, and spinal manipulation
Morehouse, M.
Annals of Internal Medicine, 1993/04
6344

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text
6345

Lower Back Pain In An Elderly Patient With Complicated History
Buser, B. R.
The AAO Journal, 1993/03
Free full text
6346

A growth industry. Graduate programs in health care are expanding rapidly
U.S. News & World Report, 1993/03
6347

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text
6348

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text
6349

Primary & Secondary Respiration – Part II
Lee, R. P.
The AAO Journal, 1993/03
Free full text
6350

Case of Birth Injury or Cranial Trauma
Lippincott, H. A.
The AAO Journal, 1993/03
Free full text
6351

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
6352

Panic Attack – Another View
Wright, H. O. L.
The AAO Journal, 1993/03
Free full text
6353

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text
6354

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text
6355

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text
6356

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text
6357

Progress in scientifically proving the benefits of OMT in treating symptoms of dysmenorrhea
Chapman, J. D.
The Journal of the American Osteopathic Association, 1993/02
Free full text
6358

Manual force, mechanically assisted articular chiropractic technique using long and/or short level contacts
Bergmann, T. F.
Journal of Manipulative and Physiological Therapeutics, 1993/01
6359

Low back pain: Evaluation of osteopathic manipulation therapy via integration and power spectrum of electromyography and psychophysical-physical analysis
Park, H. K.
Unpublished PhD thesis, 1993/01
6360

Lower back pain: Evaluation of osteopathic manipulation therapy via magnetic resonance imaging and biomechanical modeling
Sumer, A.
Unpublished PhD thesis, 1993/01
6361

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text
6362

Anatomy, Asthma and Dysautonomia
Sanders, E. C.
The AAO Journal, 1992/12
Free full text
6363

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text
6364

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text
6365

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text
6366

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text
6367

From the AOBSPOMM Files
Feely, R. A.
The AAO Journal, 1992/09
Free full text
6368

Manuelle Medizin an der Wirbelsäule--Indikation, diagnostische und therapeutische Möglichkeiten.
(Manual medicine of the spine--indication, diagnostic and therapeutic possibilities)
Kissling, R. O., Hochstrasser, R., Kubli, D.
Schweizerische Rundschau für Medizin Praxis, 1992/09
6369

Teaching the process of obtaining informed consent to medical students
Johnson, S. M., Kurtz, M. E., Tomlinson, T., Fleck, L.
Academic Medicine, 1992/09
6370

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text
6371

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09
6372

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09
6373

Kudos to Dr Frymann and colleagues
Morey, L. W.
The Journal of the American Osteopathic Association, 1992/09
Free full text
6374

Reorganizing 'traditional' case presentation enhances learning, clinical experience
Russell, B., Penney, C. W.
The Journal of the American Osteopathic Association, 1992/08
Free full text
6375

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text
6376

A Patient With Bilateral Shoulder Pain
Buser, B. R.
The AAO Journal, 1992/06
Free full text
6377

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text
6378

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text
6379

Somatic Dysfunction: A Neurophysiologic & Osteopathic Overview
Tsompanidis, A. J.
The AAO Journal, 1992/06
Free full text
6380

Rheumatoid Arthritis: The Incurable Disease?
Wright, H. O. L.
The AAO Journal, 1992/06
Free full text
6381

Effect of osteopathic medical management on neurologic development in children
Frymann, V. M., Carney, R. E., Springall, P.
The Journal of the American Osteopathic Association, 1992/06
Free full text
6382

Guidelines for designing resident rating forms
Gugelchuk, G. M., Daum, S. G.
The Journal of the American Osteopathic Association, 1992/06
Free full text
6383

HIV clinical training enhances DOs skills in the fight against AIDS
Macher, A. M., Fernandez, E. S., Rivo, M. L., Mullan, F.
The Journal of the American Osteopathic Association, 1992/06
Free full text
6384

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text
6385

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05
6386

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text
6387

'Loopholes' weaken hospital accreditation policy
Horspool, J. C.
The Journal of the American Osteopathic Association, 1992/04
Free full text
6388

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03
6389

An Integrated Approach for Treating the OB Patient: Treating the Five Diaphragms of the Body, Part II
Johnson, K.
The AAO Journal, 1992/03
Free full text
6390

The Patient Who Wouldn't Give Up
Wright, H. O. L.
The AAO Journal, 1992/03
Free full text
6391

Osteopathy & Chronic Pain
Miller, T. D.
The AAO Journal, 1992/03
Free full text
6392

Case presentation as a teaching tool: making a good thing better
Brose, J. A.
The Journal of the American Osteopathic Association, 1992/03
Free full text
6393

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text
6394

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text
6395

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text
6396

New HIV series helps to define osteopathic physicians' role in AIDS epidemic
Calabrese, L. H.
The Journal of the American Osteopathic Association, 1992/01
Free full text
6397

Cranial Osteopathy: A New Perspective
Ferguson, A.
The AAO Journal, 1991/12
Free full text
6398

A Disease Which No Longer Exists
Wright, H. O. L.
The AAO Journal, 1991/12
Free full text
6399

Alternative and complementary medicine for asthma
Lane, D. J., Lane, T. V.
Thorax, 1991/11
Free full text
6400

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text
6401

Incorporating OMT in hospital training
Cooper, G. J.
The Journal of the American Osteopathic Association, 1991/11
Free full text
6402

The Effects of Problem-based Learning on National Board Scores, Clinical Evaluations and Residency Selection of Medical Students
Tomczak, R. L.
Unpublished Dissertation, 1991/11
Free full text
6403

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text
6404

Pathophysiologic Models: Aids to the Selection of Manipulative Techniques
Hruby, R. J.
The AAO Journal, 1991/09
Free full text
6405

The osteopathic cranial concept: fact or fiction?
Ferré, J. C., Barbin, J. Y.
Surgical and Radiologic Anatomy, 1991/09
6406

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text
6407

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09
6408

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text
6409

Cystic Fibrosis and a Victory for Osteopathic Methods: A Case History
Wright, H. O. L.
The AAO Journal, 1991/09
Free full text
6410

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text
6411

Bias in medical education? Take my word for it!
Schulte, J.
Medical Economics, 1991/08
6412

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08
6413

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text
6414

Osteopathic principles and practices: maintaining a vital link in osteopathic education
Kappler, R. E.
The Journal of the American Osteopathic Association, 1991/07
Free full text
6415

Insanity or Hypoglycemia?
Wright, H. O. L.
The AAO Journal, 1991/06
Free full text
6416

Cranial osteopathy
Holmes, P.
Nursing Times, 1991/05
6417

A Report to the Statutory Advisory Committee on Medical Care: Craniosacral Manipulation
Lee, R. P.
The AAO Journal, 1991/03
Free full text
6418

Who should teach osteopathic manipulative medicine?
Lo, K. S.
The Journal of the American Osteopathic Association, 1991/03
Free full text
6419

Not every DO masters the art of manipulation
Obarski, T. P.
The Journal of the American Osteopathic Association, 1991/03
Free full text
6420

To manipulate or not to manipulate, that is the question
Padgett, D. K.
The Journal of the American Osteopathic Association, 1991/03
Free full text
6421

Evaluation of videodisc modules: a mixed method approach
Parkhurst, P. E., Lovell, K. L., Sprafka, S. A., Hodgins, M.
Proceedings Annual Symposium on Computer Application in Medical Care, 1991/02
Free full text
6422

Osteopathic research: the needed paradigm shift
Korr, I. M.
The Journal of the American Osteopathic Association, 1991/02
Free full text
6423

Our osteopathic uniqueness needs nurturing
Kuchera, W. A.
The Journal of the American Osteopathic Association, 1991/02
Free full text
6424

Erratum: An open controlled assessment of osteopathic manipulation in nonspecific low-back pain (Spine (15) 5 (364-370))
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1991/01
Free full text
6425

Osteopathic medicine
Eaton, J. A., Bates, B. P., Willard, F. H.
Orthopaedic Nursing, 1991/01
Free full text
6426

The theory of reasoned action as applied to the intention to enroll in an osteopathic medical school
Burnett, P. A.
Unpublished PhD thesis, 1991/01
6427

Osteopathic medicine and primary care practice: plan or serendipity?
Melnick, A.
Academic Medicine, 1990/12
6428

Too little and too late for GME programs
AOHA Today, 1990/12
6429

Do real DOs practice manipulation?
Cole, T. J.
The Journal of the American Osteopathic Association, 1990/12
Free full text
6430

The Historical Development of the Texas College of Osteopathic Medicine as a State Medical School, 1960-1975
Rafes, R. S.
Unpublished PhD thesis, 1990/12
Free full text
6431

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text
6432

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text
6433

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text
6434

Politics cloud state of osteopathic medical residency programs
Donovan, P. J.
The Journal of the American Osteopathic Association, 1990/10
Free full text
6435

L'ostéopathie crânienne, leurre ou realité?
(Cranial osteopathy, delusion or reality?)
Ferré, J. C., Chevalier, C., Lumineau, J. P., Barbin, J. Y.
Actualités odonto-stomatologiques, 1990/09
6436

Osteopathic medicine: the profession's role in society
Korr, I. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text
6437

Allopathic residencies: current and former residents' viewpoints
Baron, M., Karp, S. J., Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/09
Free full text
6438

Commenting on L-tryptophan and osteopathic physicians in allopathic residencies
Davis, F. E.
The Journal of the American Osteopathic Association, 1990/09
Free full text
6439

Performances of U.S. osteopathic and Canadian medical school graduates on the American Board of Internal Medicine Certifying Examinations, 1984-1988
Shea, J. A., Norcini, J. J., Benson, J. A.
Academic Medicine, 1990/08
6440

Searching for clues to the origins of OMT
Beatty, D. R.
The Journal of the American Osteopathic Association, 1990/08
Free full text
6441

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text
6442

Time to reemphasize OMT as stress reliever
Northup, G. W.
The Journal of the American Osteopathic Association, 1990/08
Free full text
6443

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text
6444

The effect of helium-neon laser and osteopathic manipulation on soft-tissue trigger points
Greene, C. H., DeBias, D. A., Helig, D., Nicholas, A. S., England, K., Ehrenfeuchter, W., Young, W. L.
The Journal of the American Osteopathic Association, 1990/07
Free full text
6445

How effectively are osteopathic medical students coping with a stressful life-style?
Kurtz, M. E., Paulsen, R. D., Ferguson, D.
The Journal of the American Osteopathic Association, 1990/07
Free full text
6446

Time to change GPs' ID
Felder, M.
The Journal of the American Osteopathic Association, 1990/06
6447

Factors influencing osteopathic physicians' decisions to enroll in allopathic residency programs
Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/06
6448

An open controlled assessment of osteopathic manipulation in nonspecific low-back pain
MacDonald, R. S., Bell, C. M. J.
Spine (Phila Pa 1976.), 1990/05
6449

Breastfeeding Opinions of Medical Students at the Oklahoma State University College of Osteopathic Medicine
Hoskins, J. A.
Unpublished MSc thesis, 1990/05
Free full text
6450

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text
6451

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text
6452

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text
6453

A second opinion on geriatric training programs
Toffol, G. J., Schultz, D. R., Root, K. E., Weintraub, J. R.
The Journal of the American Osteopathic Association, 1990/03
Free full text
6454

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text
6455

Low back pain: Evaluation of osteopathic manipulation therapy via biomechanical modeling, electromyography, muscle rigidity and pain quantification
Bolecek-Skeggs, C. M.
Unpublished PhD thesis, 1990/01
6456

An integrated osteopathic treatment approach in acute otitis media
Pintal, W. J., Kurtz, M. E.
The Journal of the American Osteopathic Association, 1989/09
Free full text
6457

Faculty Perception of Institutional Needs and Goals in an Osteopathic Medical Education Program
Fazio, L. S.
Unpublished PhD thesis, 1984/05
6458

Faculty Perceptions of Institutional Needs and Goals in an Osteopathic Medical Education Program
Fazio, L. S.
Unpublished PhD thesis, 1984/05
Free full text
6459

Towards a conceptual framework for the continuum of clinical competence development in an undergraduate osteopathic medical education program: An exploratory study
Weaver, S. A.
Unpublished PhD thesis, 1984/01
6460

Cranial Osteopathy and Its Role in Disorders of the Temporomandibular Joint
Frymann, V. M.
Dental Clinics of North America, 1983/07
6461

A Comparison of the Views of Chiropractors and Osteopathic Physicians in Western Oregon Regarding the Clinical Indications for and the Scientific Rationale Underlying Manipulative Treatment of the Low Back
Gordon, G. F.
Unpublished PhD thesis, 1982/01
6462

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01
6463

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12
6464

Les modifications du stabilogramme qu'entraînent deux ajustements ostéopathiques sont cohérentes avec l'orientation sagittale ou frontale qu'ils impliquent.
(Changes in posture induced by 2 osteopathic manipulations are coherent with the sagittal or frontal orientation they involve)
Scheibel, A., Debusschere, M.
Agressologie: revue internationale de physio-biologie et de pharmacologie appliquées aux effets de l'agression
6465

A study into the efficacy of osteopathic treatment of Irritable bowel syndrom
Brice, C., Mountford, R.
British Osteopathic Journal
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends